[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58626.1

[Show Plain Result]


## Summary of Sequence Search
    1::171
   30::149     1e-15  40%  149 aa  PF03748 FliL "Flagellar basal body-associated protein FliL"
    1::171

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVIGPQAVTGEVSADAARTNQPAIYHS
PF03748         -------------------------------------------GASAEEAAAAEAEEAAAPPPDP-VYVP


                         .         .         *         .         .         .         .:140
query           LDPAFVVNFQHQSQHRIRFLQTKMEAMARDQEVIEALQTHMPAIRNTLLLLLSQQDYETMRTVEGKERLR
PF03748         LEP-FVVNLADPG--RDRYLKVGLTLEVDDEKTAEELEAHMPLIRDAILMLLSSKTAEELSTPEGKEKLR


                         +         .         .         .         .         *         .:210
query           EAAREEINLILEAQAAVSGVEAVFFTGFVMQ
PF03748         AELLERINEVL----GKGEVEDVLFTSFVIQ