[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58831.1

[Show Plain Result]


## Summary of Sequence Search
    1::261
    1::34      8e-08  65%   39 aa  PF06429 DUF1078 "Domain of unknown function (DUF1078)"
    1::31      1e-04  58%   31 aa  PF00460 Flg_bb_rod "Flagella basal body rod protein"
    1::261

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxLWIAKTGLDAQQTRMATISNNLANVNTTGFKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06429         ----------------------------------------------------------------------
PF00460         ----LYIAGSGLQAQQTRLNVIANNIANADTPGYK-----------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06429         ----------------------------------------------------------------------
PF00460         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06429         ----------------------------------------------------------------------
PF00460         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxANVNVVEELVNMIETQRAYEMNSKAISSTDEMLRxxxxxx
PF06429         -----------SNVNLVEEMVNLIEAQRAYEANAKVITTADEMLQ------
PF00460         ---------------------------------------------------