[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58871.1

[Show Plain Result]


## Summary of Sequence Search
    1::200
   14::140     2e-21  39%  149 aa  PF03358 FMN_red "NADPH-dependent FMN reductase"
    1::200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
PF03358         ------------GNTRKLAEAAAEGAEEAG-AEVELIDLADLILPLCDKDLECEVIPDDVQELLEKLAEA


                         .         .         *         .         .         .         .:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
PF03358         DGIIFGTPTYFGSMSGQLKNFLDRLSGLWAPGALAGKPAAVFTTSGGQHGGQEATL-QLRPILAHLGMIV


                         +         .         .         .         .         *         .:210
query           Vxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03358         V-----------------------------------------------------------