[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58880.1

[Show Plain Result]


## Summary of Sequence Search
    1::163
    3::119     4e-16  35%  120 aa  PF01475 FUR "Ferric uptake regulator family"
    1::163

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
PF01475         -----------------------------------GLRLTPQRRAILELLLESDGHLSAEEIYDELKEEG


                         .         .         *         .         .         .         .:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAK
PF01475         PNISLATVYRTLDLLEEAGLVHRIESGNGKAR-YELNTGHHHHHLICEKCGKVIEFDDDEIEELLKEIAE


                         +         .         .         .         .         *         .:210
query           YLGFRVDRQTVEIxxxxxxxxxx
PF01475         KHGFKLTSHSLEL----------