[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58884.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
    2::101     2e-36  65%  104 aa  PF02777 Sod_Fe_C "Iron/manganese superoxide dismutases, C-terminal
    4::82      4e-23  63%   82 aa  PF00081 Sod_Fe_N "Iron/manganese superoxide dismutases,
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
PF02777         ----------------------------------------------------------------------
PF00081         ----LPPLPYAYDALEPHISAETMELHHGKHHQTYVNNLNAALEGTELAGKSLEEIIKKARGALFNNGGG


                         .         .         *         .         .         .         .:140
query           VWNHTFYWNCLTxxxxxEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
PF02777         -----------------EPSGELAAAIERDFGSFDAFKEEFTAAAAGRFGSGWAWLVYDEDGKLEIVSTP
PF00081         HWNHSLFWENLS----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVxxxxxx
PF02777         NQDNPLTEGLTPLLGLDVWEHAYYLDYQNRRPDYVEAFWNVVNWDEV------
PF00081         -----------------------------------------------------