[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA58916.1

[Show Plain Result]


## Summary of Sequence Search
    1::146
    9::71      1e-11  41%  135 aa  PF04246 RseC_MucC "Positive regulator of sigma(E), RseC/MucC"
    1::146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxAWVEAERRTSCHGCTLSQGCGTGSIAKYLMIKPIMVKASNPVGAEAGDRVIVGLP
PF04246         ---------------AWVECERKSACGSCAARGGCGTGALAKAGGEKTITLRVPNDLPLKVGDKVEVGIP


                         .         .         *         .         .         .         .:140
query           EKAFLQGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04246         ESSLLKAA--------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxx
PF04246         ------