[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59023.1

[Show Plain Result]


## Summary of Sequence Search
    1::212
    3::175     2e-26  39%  179 aa  PF01728 FtsJ "FtsJ-like methyltransferase"
   43::76      4e-04  50%  229 aa  PF01189 Nol1_Nop2_Fmu "NOL1/NOP2/sun family"
   43::107     5e-04  44%  234 aa  PF01209 Ubie_methyltran "ubiE/COQ5 methyltransferase family"
    1::212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
PF01728         ------------------------------SRGAFKLLEILERFGFRGSGGRVVDLGAAPGGWSQVLLQL
PF01189         ------------------------------------------------PGERVLDLCAAPGGKTTHLAAL
PF01209         ---------------------------------------------LLGPGQRVLDLAGGTGDLAFRLARA


                         .         .         *         .         .         .         .:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
PF01728         GKPAGKVVAVDLGPGEPIQGVSTLQGDITDLSTIKDVLELLPEEKVDLVLCDGAPNVSGESSPDSFISLQ
PF01189         MKNTGRVVANDI----------------------------------------------------------
PF01209         VGPTGKVVGLDILRDLGLKNVEFVQGD-------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVxxxxxxxxx
PF01728         LTLAALKLALDLLKPGGTFVIKVFKGPYMPSVLEKLEKLFRKVGLVKPPSSRNSSNEMYLV---------
PF01189         ----------------------------------------------------------------------
PF01209         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xx
PF01728         --
PF01189         --
PF01209         --