[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59139.1

[Show Plain Result]


## Summary of Sequence Search
    1::372
    1::54      9e-11  44%   70 aa  PF07282 Transposase_35 "Putative transposase DNA-binding domain"
   86::190     3e-06  31%  207 aa  PF01385 Transposase_2 "Probable transposase"
  130::206     6e-04  30%  313 aa  PF04840 Vps16_C "Vps16, C-terminal region"
    1::372

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxQHSALKETMRVFNDACNAIAEVAFREQCASKFELQKLVYADVRKQFGLSAQLTIRA
PF07282         ----------------------------------------------------------------------
PF01385         ----------------------------------------------------------------------
PF04840         --------------KESKLKQAAKLFSDSKNSAFEAKLLEEQIKLLKLQKELEEKYNANFGLSLNDTIRK


                         .         .         *         .         .         .         .:140
query           IAKVVEAYKRDKSKQCFFKPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07282         ----------------------------------------------------------------------
PF01385         ----------------------------------------------------------------------
PF04840         LIKLGQLKRAEKLKKEFKVP--------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxGAFFLLVVIDTPEAPPIDPSGFIGIDLGITKVATDSDGGSFCGSTVEXXXXXXXXXXXXLQSKGT
PF07282         ----------------------------------------------------------------------
PF01385         -----GKWYLSITVEVEVPEPLPKTGVVGIDLGLKNLATTSDGEKIVNPRLKKLEKRLKKLQRRLSSKNR
PF04840         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSAKRHLKKIRRKEAQFRRSQNHIISKRLVEKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFFQL
PF07282         ------------------------------------------------------------------FGEF
PF01385         RKARRKLARLHRKIANQRKDFLHKLSTKLVKEA-------------------------------------
PF04840         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QSFIEYKAKLAGVFVQYIDPWYTSRTCSACGHADKANRKTQSHFQCVSCGxxxxxxxxxxxxxxxxxxxx
PF07282         RRMLEYKAEWYGIEVIEVDEAYTSQTCSVCGHKKKKNRLSDREFKCPNCG--------------------
PF01385         ----------------------------------------------------------------------
PF04840         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxx
PF07282         ----------------------
PF01385         ----------------------
PF04840         ----------------------