[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59308.1

[Show Plain Result]


## Summary of Sequence Search
    1::384
   16::356     6e-54  41%  357 aa  PF01098 FTSW_RODA_SPOVE "Cell cycle protein"
    1::384

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVMVGSASLAIADGPRFLWRQGIFLLMGLAAAFVVW
PF01098         -----------------------------------VMVYSASSVYADPFYFAIRQLIFLILGLVLMFVVA


                         .         .         *         .         .         .         .:140
query           RIRLIFWERXXXXXXXXXXXXXXXXXXXXIGVEANGSRRWLAIGPISLQPSELVKLFMVVYFSGYLVRRS
PF01098         RIDYRFLRKLAPLLYLIGLLLLILVLL--FGTEVNGAKRWIRLGGFSFQPSEFAKIALILFLASYLSRKQ


                         +         .         .         .         .         *         .:210
query           YEVRTTVRXXXXXXXXXXXXXXXXXXEPDFGAVVILFATMLGMLFLGGARLWYFVXXXXXXXXXXXXXXX
PF01098         KEKRPRLKGLLPPLLLVLLPLLLILLQPDLGTALVLFAIFLGMLFLAGIRWKYILGLLLLLIGVAGLVLL


                         .         .         .         +         .         .         .:280
query           XSPYRMERLTSFLDPWSDPLDSGYQLTQALIAFGRGEWFGVGLGNSIQKLFYLPEAHTDFLYAVLAEELG
PF01098         IKPYQKARILAFLDPESDPLGAGYQLIQSLIAIGSGGLFGKGLGNGTQKLGYLPEAHTDFIFAVIGEELG


                         .         *         .         .         .         .         +:350
query           LVGSLAVIALFTVLVYRALLIGRAAERAGRVFGAYLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMS
PF01098         FIGALLVLLLFLLLILRGL---RIALRAKDPFGRLLAAGIASMIFFQVFINIGMVIGLLPVTGIPLPFIS


                         .         .         .         .         *         .         .:420
query           AGGSSIIVTCIAVALILRVDLETRxxxxxxxxxx
PF01098         YGGSSLLANMIAIGILLSISRHRR----------