[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59402.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
    1::288     4e-51  43%  303 aa  PF01207 Dus "Dihydrouridine synthase (Dus)"
  109::165     5e-05  40%  290 aa  PF01180 DHO_dh "Dihydroorotate dehydrogenase"
  187::229     3e-04  33%  256 aa  PF03437 BtpA "BtpA family"
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYH
PF01207         ----------------------SLAPMAGVTDLPFRRLCRELG-ADLLYTEMVSAKALLHGNKKTLLLLH
PF01180         ----------------------------------------------------------------------
PF03437         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFGACLMAEPELVAECVAAMAQA
PF01207         EEERPLVVQLGGSDPELLAEAAKLVAELGADGIDLNMGCPSPKVTKGGAGAALLKDPDLVAEIVRAMVAA
PF01180         ---------------EDYVECAEKLEP-GADALELNISCPNTPGLRA-----LGQDPELVELLTAAVKEA
PF03437         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRYDVVRTIKQ
PF01207         VGIPVTVKIRIGWD--DSYENALELARRLEDAGAAALTVHGR--------TRKQRYEGPADWEYIAEVKE
PF01180         TKVPVLVK--------------------------------------------------------------
PF03437         ----------------------------------------------------------PADLEDLKRVRE


                         .         .         .         +         .         .         .:280
query           DFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYV
PF01207         AVP-IPVIANGDITSLEDALRMLEETDGVMIGRGALGNPWLFRELDTGELLPPPPLAERLDILLEHLDYL
PF01180         ----------------------------------------------------------------------
PF03437         AVPDTPVLIGSGVT-LENVAEYLKIADGVIVG--------------------------------------


                         .         *         .         .         .         .         +:350
query           AEQLVQGVYLNHMTRHILGLFQGQPGARAWRRHLSExxxxxxxxxxxxxxxxxxxxx
PF01207         LEHYGEGTGLRHIRKHLLWYLKGLPGARELRRALNE---------------------
PF01180         ---------------------------------------------------------
PF03437         ---------------------------------------------------------