[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59494.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
    2::228     4e-30  37%  229 aa  PF00977 His_biosynth "Histidine biosynthesis protein"
  131::213     3e-07  37%  303 aa  PF01207 Dus "Dihydrouridine synthase (Dus)"
   14::80      5e-04  30%  262 aa  PF08584 Ribonuc_P_40 "Ribonuclease P 40kDa (Rpp40) subunit"
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
PF00977         --IIPCLDVKDGRVV-LVKGDQFTNLRDAGDPVELAKRYYEQGADELHFLDLTAAREGRPTNLEVVERIA
PF01207         ----------------------------------------------------------------------
PF08584         --------IKTGSVLALSEGRIDSDNVFALDPGVLTLSLDKETYERLGLTGKPSRFGGRK-HGRFVVEID


                         .         .         *         .         .         .         .:140
query           QALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLEFPGHILLGLDAREGKIAING
PF00977         EAVF-IPLTVGGGIRSLEDAEALLRAGADKVSIGSAAVKNPELIEEAAERFGSQIVVSIDAKRGEVATNG
PF01207         ---------------------------------------------------------------------G
PF08584         LRLPSM----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           WSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNIEATSELAKAINIPVIASGGVSSLTEIEALC
PF00977         GRESTGIDAVELAKEVEELGAGEILLTDIDRDGTLSGFDLELLRALAEAVSIPVIASGGAGSLEDLEEL-
PF01207         WDD-SYENALELARRLEDAGAAALTVHGRTRKQRYEGADWEYIAEVKEAVPIPVIANGDITSLE--DALR
PF08584         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QHEQDGIGGAIIGRALYEEKIxxxxxxxxxxxxxxxxxx
PF00977         --FEAGVDAALAGSALHEGEI------------------
PF01207         MLEETGADGVMIGR-------------------------
PF08584         ---------------------------------------