[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59517.1

[Show Plain Result]


## Summary of Sequence Search
    1::515
    1::212     1e-26  34%  212 aa  PF00006 ATP-synt_ab "ATP synthase alpha/beta family,
    1::54      7e-06  38%  106 aa  PF00306 ATP-synt_ab_C "ATP synthase alpha/beta chain, C terminal
    1::515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00006         ----------------------------------------------------------------------
PF00306         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00006         ----------------------------------------------------------------------
PF00306         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQKASSVAGV
PF00006         ---------TGIKVIDLLFPIVRGGKIGIFGGAGVGKTVISQSLIKNSNSDHI--VYVGCGERGNEMAEV
PF00306         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLR
PF00006         LMEFRKEPIMKRTTLVANTSNMPVAAREASIYTGITLAEYFRDQGKDVLMIADSISRWAEALREVSGLLG
PF00306         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISI
PF00006         RMPADVGYPAYLGAKLASLYERAGKTDRE--------------GSITIVAAVSPPAGDFSDPVPTATLGI
PF00306         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TDGQIFLETDLFNAGIRPAINAGLSVSxxxxxxxxxxxKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
PF00006         TDGFWVLDRKLAQRGIFPAINPLVSYS-------------------------------------------
PF00306         --------------------------------------REVAGRVKLTLQQYKELQAIIQISDELSEEDK


                         .         .         +         .         .         .         .:490
query           KQLERGQRVTELMKQLQYSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00006         ----------------------------------------------------------------------
PF00306         LTLERARKIREFLKQPQFVP--------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF00006         -------------------------
PF00306         -------------------------