[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for noce0:ABA59518.1

[Show Plain Result]


## Summary of Sequence Search
    1::178
    1::171     7e-27  42%  171 aa  PF00213 OSCP "ATP synthase delta (OSCP) subunit"
    1::178

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTV
PF00213         ------IARRYAKALFDAAKEKGALDEVEEELAFLAAVAKNPELREFLSNPAVSAEEKAELLIALFGEKL


                         .         .         *         .         .         .         .:140
query           TESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTF
PF00213         SEVTKNFLKLLAENGRLDLLPEIAEEFEELVAEHRGEVEATVTSAVPLSEEQLERLKAALEKKLGKKVKL


                         +         .         .         .         .         *         .:210
query           SRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLxx
PF00213         ENKVDPSLIGGVIVRVGDKVIDGSVRGKLERLKRAL--