[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56702.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mzvA.bssp"
#ERROR : Can't open dsspfile "1y0bA1.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1g2pA.bssp"
#ERROR : Can't open dsspfile "1g9sA.bssp"
#ERROR : Can't open dsspfile "1o57A2.bssp"
#ERROR : Can't open dsspfile "1vchA1.bssp"
#ERROR : Can't open dsspfile "1vdmA1.bssp"
#ERROR : Can't open dsspfile "2aeeA1.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"
#ERROR : Can't open dsspfile "1lh0A.bssp"
#ERROR : Can't open dsspfile "1u9yA2.bssp"
#ERROR : Can't open dsspfile "1a3cA.bssp"
#ERROR : Can't open dsspfile "1dqnA.bssp"
#ERROR : Can't open dsspfile "1ao0A1.bssp"
#ERROR : Can't open dsspfile "1wd5A.bssp"

## Summary of PDB Search
:214
    3e-45  36%  1mzvA  [c.61.1.1] ADENINE PHOSPHORIBOSYLTRANSFERASE
    8e-40  30%  1y0bA1 [c.61.1.1] XANTHINE PHOSPHORIBOSYLTRANSFERASE A:1 -- 191
    2e-27  15%  1bzyA  [c.61.1.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    8e-26  42%  1g2pA  [c.61.1.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1
    3e-20  15%  1g9sA  [c.61.1.1] HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE
    1e-19  23%  1o57A2 [c.61.1.1] PUR OPERON REPRESSOR A:75 -- 276
    3e-19  22%  1vchA1 [c.61.1.1] PHOSPHORIBOSYLTRANSFERASE-RELATED PROTEIN A:2 --
    5e-19  16%  1vdmA1 [c.61.1.1] PURINE PHOSPHORIBOSYLTRANSFERASE A:1 -- 153
    5e-18  14%  2aeeA1 [c.61.1.1] OROTATE PHOSPHORIBOSYLTRANSFERASE A:1 -- 208
    2e-14  20%  1a95A  [c.61.1.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-14  16%  1lh0A  [c.61.1.1] OMP SYNTHASE
    8e-14  24%  1u9yA2 [c.61.1.2] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE A:156 -- 284
    8e-13  22%  1a3cA  [c.61.1.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    1e-07  18%  1dqnA  [c.61.1.1] GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-04  22%  1ao0A1 [c.61.1.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE A:235 --
    5e-04  46%  1wd5A  [c.61.1.1] HYPOTHETICAL PROTEIN TT1426
:214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMERLKTKIRDIPDFPKPGVLFKDITPL
1mzvA           ----------------------------------------------LKKNYRWYSPIPRNVPRFADVSSI
1y0bA1          --------------------------------------------EALKRKIE------EEGVVLSDVDSF
1bzyA           -------------------------------------------------PGYDLDLFCIPNHYAEDLERV
1g2pA           --------------------------------------------QELKLALHQYPNFPSEGILFEDFLPI
1g9sA           ----------------------------------------------------------------KHTVEV
1o57A2          ------------------------------------------------------PERILPGG-YVYLTDI
1vchA1          ---------------------------------------------------RHVPLIEPLPGRRIPLVEF
1vdmA1          ------------------------------------------------------------------MDKV
2aeeA1          -------------------------------------------LDIKAVYLKPEDPFGIKSPIYTDNRVT
1a95A           ----------------------------------------------------------------------
1lh0A           ----------------------------------------------LNKQVLKFGEFTLKSGRKSPYAGL
1u9yA2          ----------------------------------------------------------------------
1a3cA           ----------------------------------------------------------------------
1dqnA           ----------------------------------------------------------------------
1ao0A1          ----------------------------------------------------------------------
1wd5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
1mzvA           TESPETLKAIRDFLVERYRTMSPTHILGFDARGFLFGPMIAVELGIPFVLMRKADKNAGLIRSEPYEKEY
1y0bA1          LNDPLLXQRIGDEFASRFAKDGITKIVTIESSGIAPAVXTGLKLGVPVVFARKHKSLTLTTASVYSFTKQ
1bzyA           FIPHGLIMDRTERLARDVMKEHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCND
1g2pA           FRNPGLFQKLKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGEC----FKATY
1g9sA           MIPEAEIKARIAELGRQITERSDMVLVGLLRGSFMFMADLCREVQVSHEVDFM-------------TASS
1o57A2          LGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDGSTV--SINYVSGSSN
1vchA1          LGDPEFTR-AAAEALRPLVPKEAEILFTTETSPIPLTHVLAEALGLPYVVARRR-RRPYMEDPIIQEVQT
1vdmA1          YLTWWQVDRAIFALAEKLREYKPDVIIGVARGGLIPAVRLSHILGDIPLKVIDVKFYKGERGEKPVI---
2aeeA1          LSYPKTRDLIENGFVETIKAHFPEVIAGTATAGIPHGAIIADKMTLPFAYIRSKPKGNQ-----------
1a95A           --TWDMLQIHARKLASRLMPSQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISS-------------Y
1lh0A           FNTGRDLALLGRFYAEALVDSEFDLLFGPAYKGIPIATTTAVALAE---------HHDKDLPYCFNRKEA
1u9yA2          -----------------------------------------------IVLAPDKGALEFA-KTASKILNA
1a3cA           --DEQAIRRALTRIAHEMIERNKCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRNDEPLVK
1dqnA           -------------------------LVALLTGAYLYASLLTVHLTLHFV----------KVSSYKGTRQE
1ao0A1          ---------------------EADVVTGVPDSSISAAIGYAEATGIGLIKNRYVGRQPSALREQGVRMKL
1wd5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHS
1mzvA           KEAAPEVMTGSIGKNSRVVLIDDVLATGGTALSGLQLVEASGAEVVEMVSILTIPFLKAAERI-------
1y0bA1          TESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRDELVKYRVES
1bzyA           QSTGIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG--
1g2pA           ESDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAP-VFT
1g9sA           RDLKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFS
1o57A2          RIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLT
1vchA1          EVLWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFR-----------------
1vdmA1          -----TIPIHGDLKDKRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACLAMKPWTSVVPDYYVFRTEK
2aeeA1          -------IEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIFTYELPKASQNFKEAGIKL
1a95A           NQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTW--
1lh0A           KDHGEGGSLVGSALQGRVMLVDDVITAGTAIRESMEIIQAHGATLAGVLISLDRQERGRGE---------
1u9yA2          EYDYLEIAPKTLDADRDVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLIGDALNKLYSAGVEE
1a3cA           GA-----DIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRSIQLAVLV-------------------
1dqnA           SVVFDEEDLKQLKEKREVVLIDEYVDSGHTIFSIQEQIKHAK---ICSCFVKDVDAIKKHSALADT----
1ao0A1          SAVR------GVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVKIS---------------------
1wd5A           --------------GRDVVLVDDGVATGASXEAALSVV--------------------------------


                         .         .         .         +         .         .         .:280
query           LVHY
1mzvA           ----
1y0bA1          LA--
1bzyA           ----
1g2pA           LL--
1g9sA           IPDE
1o57A2          LS--
1vchA1          ----
1vdmA1          WIVF
2aeeA1          ITLS
1a95A           ----
1lh0A           ----
1u9yA2          VV--
1a3cA           ----
1dqnA           ----
1ao0A1          ----
1wd5A           ----