[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56724.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e0cA1.bssp"
#ERROR : Can't open dsspfile "1okgA2.bssp"
#ERROR : Can't open dsspfile "1e0cA2.bssp"
#ERROR : Can't open dsspfile "1bohA1.bssp"
#ERROR : Can't open dsspfile "1uarA2.bssp"
#ERROR : Can't open dsspfile "1bohA2.bssp"
#ERROR : Can't open dsspfile "1urhA2.bssp"
#ERROR : Can't open dsspfile "1t3kA.bssp"
#ERROR : Can't open dsspfile "1yt8A3.bssp"
#ERROR : Can't open dsspfile "1okgA1.bssp"
#ERROR : Can't open dsspfile "1tq1A.bssp"
#ERROR : Can't open dsspfile "1yt8A2.bssp"
#ERROR : Can't open dsspfile "1yt8A4.bssp"
#ERROR : Can't open dsspfile "2gwfA1.bssp"
#ERROR : Can't open dsspfile "1yt8A1.bssp"
#ERROR : Can't open dsspfile "1c25A.bssp"
#ERROR : Can't open dsspfile "1qxnA.bssp"
#ERROR : Can't open dsspfile "1gmxA.bssp"
#ERROR : Can't open dsspfile "1hzmA.bssp"
#ERROR : Can't open dsspfile "1e0cA1.bssp"
#ERROR : Can't open dsspfile "1okgA2.bssp"
#ERROR : Can't open dsspfile "1e0cA2.bssp"
#ERROR : Can't open dsspfile "1bohA1.bssp"
#ERROR : Can't open dsspfile "1uarA2.bssp"
#ERROR : Can't open dsspfile "1bohA2.bssp"
#ERROR : Can't open dsspfile "1urhA2.bssp"
#ERROR : Can't open dsspfile "1t3kA.bssp"
#ERROR : Can't open dsspfile "1okgA1.bssp"
#ERROR : Can't open dsspfile "1tq1A.bssp"
#ERROR : Can't open dsspfile "1yt8A2.bssp"
#ERROR : Can't open dsspfile "1yt8A4.bssp"
#ERROR : Can't open dsspfile "2gwfA1.bssp"
#ERROR : Can't open dsspfile "1yt8A1.bssp"
#ERROR : Can't open dsspfile "1qxnA.bssp"
#ERROR : Can't open dsspfile "1gmxA.bssp"
#ERROR : Can't open dsspfile "1hzmA.bssp"

## Summary of PDB Search
:270
    1e-30  38%  1e0cA1 [c.46.1.2] SULFURTRANSFERASE A:1 -- 135
    3e-30  23%  1okgA2 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE
    1e-25  52%  1e0cA2 [c.46.1.2] SULFURTRANSFERASE A:136 -- 271
    2e-24  31%  1bohA1 [c.46.1.2] RHODANESE A:1 -- 149
    2e-22  42%  1uarA2 [c.46.1.2] RHODANESE A:145 -- 285
    4e-22  25%  1bohA2 [c.46.1.2] RHODANESE A:150 -- 293
    3e-17  34%  1urhA2 [c.46.1.2] 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:149 -- 268
    7e-17  19%  1t3kA  [c.46.1.1] DUAL-SPECIFICITY TYROSINE PHOSPHATASE
    8e-17  19%  1yt8A3 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:373 -- 529
    2e-16  25%  1okgA1 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:7
    2e-15  24%  1tq1A  [c.46.1.3] SENESCENCE-ASSOCIATED FAMILY PROTEIN
    9e-15  23%  1yt8A2 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:6 -- 106
    4e-14  21%  1yt8A4 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:243 -- 372
    1e-13  14%  2gwfA1 [c.46.1.4] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8 A:181 --
    3e-13  19%  1yt8A1 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:107 -- 242
    5e-13  23%  1c25A  [c.46.1.1] CDC25A
    3e-12  25%  1qxnA  [c.46.1.3] SULFIDE DEHYDROGENASE
    3e-12  20%  1gmxA  [c.46.1.3] GLPE PROTEIN
    2e-10  23%  1hzmA  [c.46.1.1] DUAL SPECIFICITY PROTEIN PHOSPHATASE 6
    3e-13  26%  1e0cA1 [c.46.1.2] SULFURTRANSFERASE A:1 -- 135(query 153->260)
    9e-10  22%  1okgA2 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE(query 9->117)
    1e-11  24%  1e0cA2 [c.46.1.2] SULFURTRANSFERASE A:136 -- 271(query 5->117)
    5e-14  21%  1bohA1 [c.46.1.2] RHODANESE A:1 -- 149(query 153->260)
    8e-13  22%  1uarA2 [c.46.1.2] RHODANESE A:145 -- 285(query 7->117)
    7e-13  15%  1bohA2 [c.46.1.2] RHODANESE A:150 -- 293(query 7->129)
    2e-08  20%  1urhA2 [c.46.1.2] 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:149 -- 268(query 5->115)
    4e-10  20%  1t3kA  [c.46.1.1] DUAL-SPECIFICITY TYROSINE PHOSPHATASE(query 153->260)
    1e-11  17%  1okgA1 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:7(query 152->260)
    6e-13  18%  1tq1A  [c.46.1.3] SENESCENCE-ASSOCIATED FAMILY PROTEIN(query 7->125)
    3e-11  27%  1yt8A2 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:6 -- 106(query 17->118)
    7e-10  26%  1yt8A4 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:243 -- 372(query 10->120)
    2e-13  12%  2gwfA1 [c.46.1.4] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8 A:181 --(query 157->260)
    5e-12  30%  1yt8A1 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:107 -- 242(query 157->260)
    2e-11  27%  1qxnA  [c.46.1.3] SULFIDE DEHYDROGENASE(query 7->127)
    7e-12  21%  1gmxA  [c.46.1.3] GLPE PROTEIN(query 153->263)
    1e-09  18%  1hzmA  [c.46.1.1] DUAL SPECIFICITY PROTEIN PHOSPHATASE 6(query 157->263)
:270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVL
1e0cA1          ---LPLVIEPADLQARLSAPELILVDLTSAARYAEGHIPGARFVDPKRTQLGQPPAPGLQPPREQLESLF
1okgA2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1bohA1          --LYRALVSTKWLAESVRAGGLRVLDREARKEYLERHVPGASFFDIEECRDKASPYEVMLPSEAGFADYV
1uarA2          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1t3kA           MAMARSYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNVKDKDTLVFHS
1yt8A3          ------TIDPTTLADWLGEPGTRVLDFTASANYAKRHIPGAAWVL--------------------RSQLK
1okgA1          ------FLDPSEVADHLAERYSLKIKDHGSIQYAKEHVKSAIRADVDTNLSKLVTARHPLPPXAEFIDWC
1tq1A           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
2gwfA1          ------AITAKELYTMMTDKNLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP--DDSKD
1yt8A1          ------SLAAEEVQALLDAREAVILDARRFDEYQTXSIPGGISVPGAE-----------------LVLRV
1c25A           ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------
1gmxA           ------CINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTL-------------GAF-----
1hzmA           ---------VAWLNEQLELGNLLLMDCRPQELYESSHIESAINVAIPGIMLRRLPVRALFTRGEDRDRFT
1e0cA1          ----------------------------------------------------------------------
1okgA2          --------QHHYLVDEIP-PQAIITDARSADRFASTHIEGARNLPYTSHLVTRGDG-KVLRSEEEIRHNI
1e0cA2          ----EPTASRDYLLGRLGAADLAIWDARSPQEYKGGHIPGAVNFEWTAAMDP----SRALRIRTDIAGRL
1bohA1          ----------------------------------------------------------------------
1uarA2          ------RDDVLEHIIKVKEGKGALVDVRSPQEYRGEHIPGAKNIPWAKAVNP----DGTFKSAEELRALY
1bohA2          ------LKTYEQVLENLESKRFQLVDSPDAVGLDSGHIRGSVNMPFMNFLTE----DGFEKSPEELRAMF
1urhA2          ----EAVVKVTDVLLASHENTAQIIDAAEVDELRRGHIPGALNVPWTELVRE---GELKTTDELDA--IF
1t3kA           ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1tq1A           ------SVSVTVAHDLLLA-GHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMS---KNTDFLEQVSS-
1yt8A2          ----------------LARRELALLDVREEDPFAQAHPLFAANLPLS-----------------RLELEI
1yt8A4          ---------LAGLAQWQDERTTYLLDVRTPEEYEAGHLPGSRSTPGGQLV-----------------QET
2gwfA1          ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1qxnA           ------MLSPKDAYKLLQEPDITLIDVRDPDELKAMGKPDVKNYKHMSR--------------GKLEPLL
1gmxA           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRY
1e0cA1          GELGHRPEAVYVVYDDEGGGWAGRFIWLLDVIGQQRYHYLNGGLTAWLAEDRPL----------------
1okgA2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------PVALSL
1bohA1          GSLGISNDTHVVVYDGDGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP-------
1uarA2          ----------------------------------------------------------------------
1bohA2          -----------------------------------------------------------------FKATL
1urhA2          ----------------------------------------------------------------------
1t3kA           ALSQ-------VRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDC----
1yt8A3          QALERLGTAERYVLTCGSSLLARFAVAEVQALSGKPVFLLDGGTSAWVAAGLPTEDGESLLASPRIDRYR
1okgA1          XANGXAGELPVLCYDDECGXGGCRLWWXLNSLGADAY-VINGGFQACKAAGLEXESGEPSSLPRPAT---
1tq1A           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
2gwfA1          TWKKRGNVEYVVLLDWFSSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTN-------------
1yt8A1          AELAPDPRTRVIVNCAGRT-RSIIGTQSLLNAGIPNVAALRNGTIGWTLAGQQLEHGQTRRFG-------
1c25A           --------------------------------------MLIGDFSKGYLFHTVAGKHQDLKYISP-----
1qxnA           ----------------------------------------------------------------------
1gmxA           -MRDNDFDTPVMVMXYHGN-SSKGAAQYLLQQGYDVVYSIDGGFEAWQRQFPAE----------------
1hzmA           RRCGT---DTVVLYDESSSDWNENTGGESLKDEGCRAFYLEGGFSKFQ-AEFSL----------------
1e0cA1          ----------------------------------------------------------------------
1okgA2          XTVVQADLSSFVFSXGSGV-TACINIALVHHLGLGHPYLYCGSWSEY-----------------------
1e0cA2          EELGITPDKEIVTHXQTHH-RSGLTYLIAKALGYPRVKGYAGSWGEW-----------------------
1bohA1          ----------------------------------------------------------------------
1uarA2          EPLGITKDKDIVVYXRIAERSSHSWFVLKYLLGYPHVKNYDGSWTEW-----------------------
1bohA2          EAKKVDLTKPLIATXRKGV-TACHIALAAYLCGKPDVAIYDGSWFEWFHRAPPETWVSQ-----------
1urhA2          FGRGVS--YDKPIIVSXGSGTAAVVLLALATLDVPNVKLYDGAWS-------------------------
1t3kA           ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1tq1A           ---HFGQSDNIIVGCQSGG-RSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK---------------
1yt8A2          HARVPRRDTPITVYDDGEG-LAPVAAQRLHDLGYSDVALLDGGLSGWR----------------------
1yt8A4          DHVASVRGARLVLVDDDGV-RANXSASWLAQXGWQVAV-LDGLSEADFSE--------------------
2gwfA1          ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1qxnA           AKSGLDPEKPVVVFCKTAA-RAALAGKTLREYGFKTIYNSEGGMDKWLEEGLPSLDR-------------
1gmxA           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QGHQAADKEYILAHLLDPKVVILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDEL
1e0cA1          ----------------------------------------------------------------------
1okgA2          --------HYLVDEI-PPQAIITDARSADRFASTYAADKXPGHIEGARNLPYTSHLVTRDGKVLRSEEEI
1e0cA2          HDEPTASRDYLLGRLGAADLAIWDARSPQEYRGEKVLAAKGGHIPGAVNFEWTAAMDPSRALRIR--TDI
1bohA1          ----------------------------------------------------------------------
1uarA2          --------LEHIIKVKEGKGALVDVRSPQEYRGELEGALRAGHIPGAKNIPWAK--AVNPDGTFKSAEEL
1bohA2          NRSLLKTYEQVLENLESKRFQLVDSRAQGRYLGTQPEPDDSGHIRGSVNMPFMNFLT--EDGFEKSPEEL
1urhA2          ------KVTDVLLASHENTAQIIDARPAARFNAE-VDELRRGHIPGALNV---------------PWTEL
1t3kA           ----------------------------------------------------------------------
1yt8A3          RPYEGTDNPREAXQGYFGLVEQLGRDGTHGFFV-------------------------------------
1okgA1          ----------------------------------------------------------------------
1tq1A           -----------AHDLLLAGHRYLDVRTPEEF--------SQGHACGAINVPYMNRGA-----SGMSKNTD
1yt8A2          ------------------ELALLDVREEDPF--------AQAHPLFAANL---------------PLSRL
1yt8A4          -----------WQDEHDRTTYLLDVRTPEEY--------EAGHLPGSRST---------------PGGQL
2gwfA1          ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1c25A           --EIMASVLNGKFANLIKEFVIIDCRYPYEY--------EGGHIKGAVNLHMEEEVEDFLLKKP------
1qxnA           ----------------NPDITLIDVRDPDEL--------KAMGKPDVKNYKH------------MSRGKL
1gmxA           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------
1e0cA1          ------------ARLSAPELILVDLTSAARY--------AEGHIPGARFVDPTQLGQPPAPGLQPPREQL
1okgA2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1bohA1          ------------AGKVGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDKASPYEVMSEAGF
1uarA2          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1t3kA           ------------PLHRRPNIAIIDVRDEERN--------YDGHIAGSLHYASGS------------FDDK
1okgA1          -----------VADHLA-EYRIVDCRYSLKIKDHGSIQYAKEHVKSAIRADVDTNLSKLVPTSLPPXAEF
1tq1A           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
2gwfA1          ----------------NISLIIMDARRMQDY--------QDSCILHSLSVPEEAISPGVTASWIEAHLPD
1yt8A1          ----------------RAEAVILDARRFDEY--------QTXSIPGGISVPG---------------AEL
1qxnA           ----------------------------------------------------------------------
1gmxA           ------------QKLQEKEAVLVDIRDPQSF--------AMGHAVQAFHLTNDT-------LGAFMRD--
1hzmA           ----------------NERLLLMDCRPQELY--------ESSHIESAINVAIPGIMLRRL----------


                         .         .         .         +         .         .         .:280
query           RSSLEALGITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWGNAPDTPIKV
1e0cA1          ------------------------------------------------------------
1okgA2          RHNIXTVVQADLSSFVFSXGSGVTACINIALVHHLGLGHPYLYCGSWSEYSGLFRPPI--
1e0cA2          AGRLEELGITPDKEIVTHXQTHHRSGLTYLIAKALGYPRVKGYAGSWGEWGNHPDTPVEL
1bohA1          ------------------------------------------------------------
1uarA2          RALYEPLGITKDKDIVVYXRIAERSSHSWFLKYLLGYPHVKNYDGSWTEWGNLVGVPI--
1bohA2          RAMFEAKKVDLTKPLIATXRKGVTACHIALAAYLCGKPDVAIYDGSWFEWFHRPETWV--
1urhA2          VREGELK--TTDELDAIFFGRGVSYDKPIIVLATLDVPNVKLYDGAWSE-----------
1t3kA           ------------------------------------------------------------
1yt8A3          ------------------------------------------------------------
1okgA1          ------------------------------------------------------------
1tq1A           FLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAW----------
1yt8A2          ELEIHARVPRRDTPITVYDDGEGLAPVAAQRLHDLGYSDVALLDGGLSGW----------
1yt8A4          VQETDHVASVRGARLVLVDDDGVRANXSASWLAQXGWQVAVLSEADFSERGAWS------
2gwfA1          ------------------------------------------------------------
1yt8A1          ------------------------------------------------------------
1c25A           ----IVPTDGKRVIVVFHCEFSERGPRMCRYVRELHYPELYVLKGGYKEF----------
1qxnA           EPLLAKSGLDPEKPVVVFCKTAARAALAGKTLREYGFKTIYNSEGGMDKWLEE-------
1gmxA           ------------------------------------------------------------
1hzmA           ------------------------------------------------------------
1e0cA1          ESLFGELGHRPEAVYVVYDEGGGWAGRFIWLLDVIGQQRYHYLNGGLTAW----------
1okgA2          ------------------------------------------------------------
1e0cA2          ------------------------------------------------------------
1bohA1          ADYVGSLGISNDTHVVVYDGDDLGSFYAPRVFRVFGHRTVSVLNGGFRNW----------
1uarA2          ------------------------------------------------------------
1bohA2          ------------------------------------------------------------
1urhA2          ------------------------------------------------------------
1t3kA           ISHLVQNVKDKDTLVFHSALSQVRGPTCARRLEDTGIKNIMILERGFNGW----------
1okgA1          IDWCXANGXAGELPVLCYDDECGGGCRLWWXLNSLGA-DAYVINGGFQAC----------
1tq1A           ------------------------------------------------------------
1yt8A2          ------------------------------------------------------------
1yt8A4          ------------------------------------------------------------
2gwfA1          DSKDTWKKRGNVEYVVLLDWFSSAKALFKWESKTVLRNEPLVLEGGYENW----------
1yt8A1          VLRVAELAPDPRTRVIVNCAGRTRSIIGTQSLLNAGIPPVAALRNGTIGW----------
1qxnA           ------------------------------------------------------------
1gmxA           --------NDFDTPVMVMXYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQ-------
1hzmA           -----------QKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNEN-------