[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56789.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eyzA3.bssp"
#ERROR : Can't open dsspfile "1ehiA2.bssp"
#ERROR : Can't open dsspfile "1glvA2.bssp"
#ERROR : Can't open dsspfile "1vkzA3.bssp"
#ERROR : Can't open dsspfile "1b6rA3.bssp"
#ERROR : Can't open dsspfile "2pbzA2.bssp"
#ERROR : Can't open dsspfile "1bncA3.bssp"
#ERROR : Can't open dsspfile "1a9xA5.bssp"
#ERROR : Can't open dsspfile "1gsoA3.bssp"
#ERROR : Can't open dsspfile "1iovA2.bssp"
#ERROR : Can't open dsspfile "1e4eA2.bssp"
#ERROR : Can't open dsspfile "3eeqA1.bssp"
#ERROR : Can't open dsspfile "1cqiB2.bssp"
#ERROR : Can't open dsspfile "1w93A3.bssp"
#ERROR : Can't open dsspfile "1pszA.bssp"

## Summary of PDB Search
:307
    6e-16  10%  1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
    6e-13  14%  1ehiA2 [d.142.1.1] D-ALANINE:D-LACTATE LIGASE A:135 -- 362
    2e-12  20%  1glvA2 [d.142.1.1] GLUTATHIONE SYNTHASE A:123 -- 316
    1e-10  12%  1vkzA3 [d.142.1.2] PHOSPHORIBOSYLAMINE--GLYCINE LIGASE A:94 -- 313
    1e-10  11%  1b6rA3 [d.142.1.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    9e-10  12%  2pbzA2 [d.142.1.9] HYPOTHETICAL PROTEIN A:100 -- 312
    2e-09  15%  1bncA3 [d.142.1.2] BIOTIN CARBOXYLASE A:115 -- 330
    2e-09  18%  1a9xA5 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    9e-09  16%  1gsoA3 [d.142.1.2] PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
    1e-08  17%  1iovA2 [d.142.1.1] D-ALA\:D-ALA LIGASE A:97 -- 306
    4e-08  16%  1e4eA2 [d.142.1.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    2e-06   7%  3eeqA1 [c.151.1.1] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G A:215
    5e-05  13%  1cqiB2 [d.142.1.4] PROTEIN (SUCCINYL-COA SYNTHETASE BETA CHAIN) B:1
    6e-05  18%  1w93A3 [d.142.1.2] ACETYL-COENZYME A CARBOXYLASE A:184 -- 450
    4e-04  18%  1pszA  [c.92.2.2] PROTEIN (SURFACE ANTIGEN PSAA)
:307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVRGIAAGSF
1eyzA3          ----------------------------------------------------------------------
1ehiA2          ----------------------------------------------------------------------
1glvA2          ----------------------------------------------------------------------
1vkzA3          ----------------------------------------------------------------------
1b6rA3          ----------------------------------------------------------------------
2pbzA2          ----------------------------------------------------------------------
1bncA3          ----------------------------------------------------------------------
1a9xA5          ----------------------------------------------------------------------
1gsoA3          ----------------------------------------------------------------------
1iovA2          ----------------------------------------------------------------------
1e4eA2          ----------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1cqiB2          ----------------------------------------------------------------------
1w93A3          ----------------------------------------------------------------------
1pszA           --------DPHAWLNKNIAKQLSPNNKEFYEKNLKEYKLDLDKESKDKFNKI------PAEKKLIVTGAF


                         .         .         *         .         .         .         .:140
query           EQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
1eyzA3          -------------------------------REGIRRLAAEELQLPTSTYRFADSESLFR---EAVADIG
1ehiA2          -------------------------------DKALTKELLTVNGIRNTKYIVVDPESANWSWDKIVAELG
1glvA2          --------------------------------------FTAWFSDLTPETLVTRNKAQLKA----FWEKH
1vkzA3          --------------------------------KVYAKRFXKKYGIRTARFEVAETPEELR---EKIKKFS
1b6rA3          -------------------------------DRLTQKQLFDKLHLPTAPWQLLAERSEWP---AVFDRLG
2pbzA2          ------------------------------------------------------ELQDKA---LEGAGIP
1bncA3          -------------------------------DKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKR--
1a9xA5          -------------------------------DRRRFDVAMKKIGLETARSGIAHTMEEAL---AVAADVG
1gsoA3          --------------------------------KAFTKDFLARHKIPTAEYQNFTEVEPAL---AYLREKG
1iovA2          --------------------------------KLRSKLLWQGAGLPVAPWVALTRAEFEKGLSDKQLAEI
1e4eA2          -------------------------------DKSLTYIVAKNAGIATPAFWNKDDRPVAATFTY------
3eeqA1          ------------------------KDVKMEEIRDGIYKVLERLNLKRERIGIIASIREE--VKKIADEFN
1cqiB2          -------------------------------HEYQAKQLFARYGLPAPVGYACTTPREAE---EAASKIG
1w93A3          ----------------KVPCIWSGTGVDTVHVDEKTGLVSV--DDDIYQKGCCTSPEDGL---QKAKRIG
1pszA           KYFSKAYGVPSAYIWEINTEEETPEQIKTLVEK------LRQTKVPSLFVESSVDDRPMK---TVSQDTN


                         +         .         .         .         .         *         .:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
1eyzA3          YPCIVKPVMSSSGKGQTFIRSAEQLAQAGGRAGRVIVEGVVKFDF---EITLLTVSAVDGVHFCAPVGHR
1ehiA2          NIVFVKAANQGSSVGISRVTNAEEYTESFQYDYKVLIEEAV-----NGARELEVGVIGNDQPLVSEIGAH
1glvA2          SDIILKPLDASIFRVKEGDPNLGVIALTEHGTRYCMAQNYLPAIK---DGDKRVLVVDGEPVPYCLARGG
1vkzA3          PPYVIKADGLARGKGVLILDSKEETIEIKGVKGPVVIDEFLAGNELSANGRNFVILPFVRDYKRLXDGDR
1b6rA3          ELAIVKRRTGQWRLRANETEQLP-----AECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQ
2pbzA2          RVEVVEPEDAKPDELYFVRIEGSELEERFIPGVYLYVHFFYSP----ILERLELLGVDERVLIADGNARW
1bncA3          ---IGYPVIIKRGMRVVRAELAQSISMTRAEAKMVYMEKYLENPRHVEIQDGQGNAIYLAERDCSMQRRH
1a9xA5          FPCIIRPSFTMGGSGGGIAYNREEFEEILSPTKELLIDES-----LIGWKEYEMEVVRDKIVCSIENFDA
1gsoA3          APIVIKAKGVIVAMTLEEAEAAVHDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDH
1iovA2          SALIVKPSREGSSVGMSKVVAENALRLAFQHDEEVLIEKWLSGPE------FTVAILGEEILPSFYDYEA
1e4eA2          -PVFVKPARSGSSFGVKKVNSADELESARQYDSKILIEQAVCEVGCAVLGNSAALVVGEVQYGIFRIHQE
3eeqA1          VRFRLVNEEEINNFMNPCLTPPSKTKGAGGRNSKLILRKIAIS------RNSTIAVAT------------
1cqiB2          AGPWVVKCQKVVNSKEDIRAFAENWLGQTDANGQPLVEAATDIAKELYLG-AVVDRSSRRVVFMASTEGG
1w93A3          FPVMIKASEGGGGKGIRQVEREEDFIALEIPGSPIFIMKLAGRA---RHLEVQLLADQYGTNCSVQRRHQ
1pszA           IPIYAQIFTDSIAEQGKEGDSYYSMM--------------------------------------------


                         .         .         .         +         .         .         .:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVN
1eyzA3          QGDYRESWQPQQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDMVTLISQDLS
1ehiA2          KFVDNSAVHPAQLSPEVTKEVKQMALDAYKVLLRGEARMDFLLDENNVPYLGEPNTLPGFTNMSDYSDIN
1glvA2          GGE----------PRPLTESDWKIARQ--IGPTLKEKGLIFVGLDIIGDRLTEINSPTCIREIEAEFPVS
1vkzA3          GP--NTGGXGSWGPVEIPSDTIKKIEELFDKTLEGYAYRGFLYLHDGDPYILEYNVRLGDEVIVTLNPEG
1b6rA3          DGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWNGASIS
2pbzA2          PVKPLPYTIVGNRAIALLPQLYDYGLAFVRTXPPGVIGPFALHAYDGSFKAIGIASRIDGGS--------
1bncA3          QKVVEEAPAPGITPE-LRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVPVTEMITGVD
1a9xA5          MGIHTGDSIAQTLTDKEYQIMRNASMAVLREIGVETGGVQFAVNPKNGLIVIEMNPRVS-----------
1gsoA3          KRVTGPNTGGMYSPAPTMERIIWPTVKGMAAEGNTYTGFGLMIDKQGNPKVIEFNCRFGDLETQLRMKSD
1iovA2          KYLSDETQYPAGLEASQEANLQALVLKAWTTLGCKWGRIDVMLDSDGQFYLLEANTSPGM----------
1e4eA2          VEPEKGSENAVIVPADLRGRIQETVKKIYKTLCRGLARVDMFLQDNGRIVLNEVNTLPGF----------
3eeqA1          ----------------------------------------------------------------------
1cqiB2          VEIEKVAEELTGPMPYQGRELAFKLGLEGKLVQQFTKIFLATIFLERDLALIEINPLVITKQGDL-ICLD
1w93A3          KII--EEAPVTIAKAETFHEMEKAAVRLGKLVGYVSAGVEYLYSHDDGFYFLELN---------------
1pszA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IAGALAKNLLERLHSxxxxxxxxxxxx
1eyzA3          EFALHVRAFL-----------------
1ehiA2          NAKLVDMLIDYGFE-------------
1glvA2          ITGMLMDAIEARL--------------
1vkzA3          FVNAVLEGYRGGK--------------
1b6rA3          QFELHLRAITLPLPQ------------
2pbzA2          ---------------------------
1bncA3          LIKEQLRIAA-----------------
1a9xA5          ---------------------------
1gsoA3          LVELCLAACESKLDE------------
1iovA2          ---------------------------
1e4eA2          ---------------------------
3eeqA1          ---------------------------
1cqiB2          GKLGADGNALFR---------------
1w93A3          ---------------------------
1pszA           ---------------------------