[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56844.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bwzA2.bssp"
#ERROR : Can't open dsspfile "1to6A.bssp"
#ERROR : Can't open dsspfile "1bwzA1.bssp"
#ERROR : Can't open dsspfile "1t6kA1.bssp"
#ERROR : Can't open dsspfile "1qy9A1.bssp"
#ERROR : Can't open dsspfile "1t6kA2.bssp"
#ERROR : Can't open dsspfile "1u0kA2.bssp"
#ERROR : Can't open dsspfile "1s7jA.bssp"
#ERROR : Can't open dsspfile "2edmA1.bssp"

## Summary of PDB Search
:276
    4e-48  46%  1bwzA2 [d.21.1.1] PROTEIN (DIAMINOPIMELATE EPIMERASE) A:131 -- 274
    3e-41  10%  1to6A  [c.141.1.1] GLYCERATE KINASE
    9e-37  53%  1bwzA1 [d.21.1.1] PROTEIN (DIAMINOPIMELATE EPIMERASE) A:1 -- 130
    1e-28  23%  1t6kA1 [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF A:1 -- 128
    8e-28  21%  1qy9A1 [d.21.1.2] HYPOTHETICAL PROTEIN YDDE A:3 -- 129
    3e-24  16%  1t6kA2 [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF A:129 -- 278
    1e-17  17%  1u0kA2 [d.21.1.2] GENE PRODUCT PA4716 A:131 -- 283
    2e-09  18%  1s7jA  [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF FAMILY
    7e-05  15%  2edmA1 [b.170.1.1] 22KDA STRUCTURAL PROTEIN VP22 A:41 -- 201
:276

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
1bwzA2          ----------------------------------------------------------------------
1to6A           -QLALFEVDLVGLGKIPLEKRNPLQIQTHLISQEIKEIYIGVGGTASNDGGIGIAA--GLGYQFYDEDGN
1bwzA1          --MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQLLIVEAPYDPELDFHYRIFNADGS
1t6kA1          ---AFASVPLEGNPVAVFFDADD---LPPAQMQRIARE---MNLSESTFVLKPR-NGGDALIRIFTPV-N
1qy9A1          ---AFTSQPFRGNSAGVVFPADNL---SEAQXQLIAR---ELGHSETAFLLHS--DDSDVRIRYFTPTV-
1t6kA2          ----------------------------------------------------------------------
1u0kA2          ----------------------------------------------------------------------
1s7jA           ----------------------------------------------------------SYALRWFTPER-
2edmA1          ----------------------------------------------------------NMTLKILNNTG-


                         .         .         *         .         .         .         .:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
1bwzA2          ----------------------------------------------------------------NKFEKN
1to6A           ALPACGQSLLNLASVSTENRYKIPEDVHIRILADVVSPLCGHQGATYTFGKQKGLDSTMFEVVDQAIQDF
1bwzA1          EVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNMVLTVKDMNQIRVNMGEPIWEPAKIPF--------
1t6kA1          ELPFAGHPLLGTAIALGAHT--DNHRLYLETQMGTIAFELERQNAASMDQPIPTWTA-------------
1qy9A1          EVPICGHATVAAHYVRAKVLGLGNCTIWQTSLAGKHRVTIEKHNDISLEQGTPGFEP-------------
1t6kA2          ----------------------------------------------------------------------
1u0kA2          ----------------------------------------------------------------------
1s7jA           EIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEY-YYLDF--PYILPERIPILPEYEAAL
2edmA1          VDLLINDITVRPTVIAGNIKGNTMSNTYF--SSKDIKSSSSKITLIDVCSGAAFEATMNIGFT-------


                         +         .         .         .         .         *         .:210
query           YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
1bwzA2          YILRTDIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYE
1to6A           ---------YEKVSPATLKLKGAGAGGGIAGGLCAFAQASIVGIDTCLDLID------------------
1bwzA1          ----------------------------------------------------------------------
1t6kA1          ----------------------------------------------------------------------
1qy9A1          ----------------------------------------------------------------------
1t6kA2          KALGISDSTFPIEIYHNGPRHVFVGLP--SIDALSALHPDHRALSNFHDMAINCFAGAGRRWRSRMFSPA
1u0kA2          -----DLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALD----KLGAAFVYLLDVDGREGRTWD
1s7jA           --------GTKIYEAYLG-RDLFFVLKDEET--------VAKITPDFSKALDLGVGVIVTASGDSVDFVS
2edmA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RXXXXXXXXXXXXXXXXVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL
1bwzA2          RGAGETQACGSGACAAVAVGIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL
1to6A           ------------------------------------------------------------------
1bwzA1          ------------------------------------------------------------------
1t6kA1          ------------------------------------------------------------------
1qy9A1          ------------------------------------------------------------------
1t6kA2          YGVVEDAATGSAAGPLAIHLARHGQIEFGQPVEIRPSLMFAKAEGRATRVEVSGNGVTFGRGTIVL
1u0kA2          NGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLRPSRLDVQVATDG-SVRVGGHVQLLARAEL--
1s7jA           RTFFPKLRINEDPVCGSAHANLIPYWGKRLNVSPRGGFLTCEVKEN--RVIIGGTAKLFAKGEAYL
2edmA1          ------------------------------------------------------------------