[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56902.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2basA1.bssp"
#ERROR : Can't open dsspfile "1w25A3.bssp"
#ERROR : Can't open dsspfile "1tufA2.bssp"
#ERROR : Can't open dsspfile "3byqA1.bssp"
#ERROR : Can't open dsspfile "1azsA.bssp"
#ERROR : Can't open dsspfile "2axtC1.bssp"
#ERROR : Can't open dsspfile "1wc0A.bssp"
#ERROR : Can't open dsspfile "1s66L.bssp"
#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "2veaA3.bssp"
#ERROR : Can't open dsspfile "1d7eA.bssp"
#ERROR : Can't open dsspfile "1a04A2.bssp"
#ERROR : Can't open dsspfile "3c2wA3.bssp"
#ERROR : Can't open dsspfile "1ll8A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1a0oA.bssp"
#ERROR : Can't open dsspfile "1a2oA1.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1f51E.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1oj5A.bssp"
#ERROR : Can't open dsspfile "2oolA2.bssp"
#ERROR : Can't open dsspfile "1ny5A1.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "1bywA.bssp"
#ERROR : Can't open dsspfile "1p2fA2.bssp"
#ERROR : Can't open dsspfile "1tu1A.bssp"
#ERROR : Can't open dsspfile "1vm6A2.bssp"
#ERROR : Can't open dsspfile "1p97A.bssp"
#ERROR : Can't open dsspfile "2fi0A1.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1g28A.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "2b4aA1.bssp"
#ERROR : Can't open dsspfile "1cb7A.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1bmtA2.bssp"
#ERROR : Can't open dsspfile "1w25A2.bssp"
#ERROR : Can't open dsspfile "2nx2A1.bssp"

## Summary of PDB Search
:696
    7e-38  23%  2basA1 [c.1.33.1] YKUI PROTEIN A:2 -- 262
    8e-24  23%  1w25A3 [d.58.29.2] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    8e-17  11%  1tufA2 [c.1.6.1] DIAMINOPIMELATE DECARBOXYLASE A:50 -- 313
    2e-16   9%  3byqA1 [d.79.9.1] UNCHARACTERIZED PROTEIN DUF1185 A:2 -- 192
    6e-16  11%  1azsA  [d.58.29.1] VC1
    1e-13   6%  2axtC1 [f.55.1.1] PHOTOSYSTEM II CP43 PROTEIN C:27 -- 473
    8e-12   9%  1wc0A  [d.58.29.1] ADENYLATE CYCLASE
    3e-11  22%  1s66L  [d.110.3.2] HYPOTHETICAL PROTEIN YDDU
    3e-10  23%  1d06A  [d.110.3.2] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    5e-10  12%  2veaA3 [d.110.3.9] PHYTOCHROME-LIKE PROTEIN CPH1 A:4 -- 130
    2e-09  12%  1d7eA  [d.110.3.1] PHOTOACTIVE YELLOW PROTEIN
    4e-09  13%  1a04A2 [c.23.1.1] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    6e-09  17%  3c2wA3 [d.110.3.9] BACTERIOPHYTOCHROME A:5 -- 117
    7e-09  15%  1ll8A  [d.110.3.5] PAS KINASE
    7e-09  12%  1dz3A  [c.23.1.1] STAGE 0 SPORULATION PROTEIN A
    3e-08  17%  1a0oA  [c.23.1.1] CHEY
    2e-07  14%  1a2oA1 [c.23.1.1] CHEB METHYLESTERASE A:1 -- 140
    2e-07  16%  1oxbB  [c.23.1.1] SLN1
    2e-07  15%  1f51E  [c.23.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    2e-07  22%  1b00A  [c.23.1.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    3e-07  16%  1oj5A  [d.110.3.8] STEROID RECEPTOR COACTIVATOR 1A
    4e-07   9%  2oolA2 [d.110.3.9] SENSOR PROTEIN A:26 -- 139
    5e-07  14%  1ny5A1 [c.23.1.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) A:1 --
    4e-06  20%  1d5wA  [c.23.1.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    4e-06  19%  1tmyA  [c.23.1.1] CHEY PROTEIN
    6e-06  22%  1bywA  [d.110.3.6] PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
    7e-06  21%  1p2fA2 [c.23.1.1] RESPONSE REGULATOR A:1 -- 120
    1e-05   6%  1tu1A  [d.107.1.3] HYPOTHETICAL PROTEIN PA0094
    1e-05  15%  1vm6A2 [d.81.1.3] DIHYDRODIPICOLINATE REDUCTASE A:97 -- 182
    1e-05  15%  1p97A  [d.110.3.7] ENDOTHELIAL PAS DOMAIN PROTEIN 1
    3e-05  11%  2fi0A1 [a.248.1.1] CONSERVED DOMAIN PROTEIN A:3 -- 81
    3e-05  15%  1i3cA  [c.23.1.1] RESPONSE REGULATOR RCP1
    5e-05  15%  1g28A  [d.110.3.6] PHY3 PROTEIN
    6e-05  17%  1m5tA  [c.23.1.1] CELL DIVISION RESPONSE REGULATOR DIVK
    1e-04  14%  1p6qA  [c.23.1.1] CHEY2
    1e-04  17%  1dcfA  [c.23.1.2] ETR1 PROTEIN
    1e-04  14%  2b4aA1 [c.23.1.1] BH3024 A:2 -- 119
    1e-04  15%  1cb7A  [c.23.6.1] PROTEIN (GLUTAMATE MUTASE)
    1e-04  17%  1l5yA  [c.23.1.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    3e-04  19%  1s8nA  [c.23.1.1] PUTATIVE ANTITERMINATOR
    4e-04  14%  1bmtA2 [c.23.6.1] METHIONINE SYNTHASE A:741 -- 896
    5e-04  21%  1w25A2 [c.23.1.1] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    8e-04  12%  2nx2A1 [c.129.1.2] HYPOTHETICAL PROTEIN YPSA A:1 -- 177
:696

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQSWDIIVCAAMLPQFSVAR
2basA1          ----------------------------------------------------------------------
1w25A3          ----------------------------------------------------------------------
1tufA2          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2axtC1          ----------------------------------------------------------------------
1wc0A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1a04A2          --------TILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLE
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           -------IKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLA
1a0oA           -------LKFLVVDDFSTMRRIVRNLLKELGF-NNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLE
1a2oA1          --------RVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLD
1oxbB           -------VKILVVEDNHVNQEVIKRMLNLEGIEACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLL
1f51E           --------KILIVDDQSGIRILLNEVFNKEGYQTFQ--AANGLQALDIVTKERPDLVLLDMKIPGMDGIE
1b00A           --------RILVVEDEAPIREMVCFVLEQNGFQPVE--AEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQ
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          -------MNVLVIEDDKVFRGLLEEYLSMKGIKVES--AERGKEAYKLLSEKHFNVVLLDLLLPDVNGLE
1d5wA           --------TVHIVDDEEPVRKSLAFMLTMNGFAVKM--HQSAEAFLAFAPDVRNGVLVTXLRMPDMSGVE
1tmyA           --------RVLIVDDAAFMRMMLKDIITKAGYEVAGE-ATNGREAVEKYKELKPDIVTMDITMPEMNGID
1bywA           ----------------------------------------------------------------------
1p2fA2          --------KIAVVDDDKNILKKVSEKLQQLG------RVKTFLTGEDFLNDEAFHVVVLDVXLPDYSGYE
1tu1A           --------DLEIPDAWQDQIFKLPASGPAREA-----SFVISRDASQGDAPADYVARQLENAEKQLPGFK
1vm6A2          ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           --------VILLVEDSKADSRLVQEVLKTSTIDHELAAXAFLQQQGEYENSPRPNLILLDLNLPKKDREV
1g28A           ----------------------------------------------------------------------
1m5tA           --------KVLIVEDNELNMKLFHDLLEAQGYETLQ--TREGLSALSIARENKPDLILMDIQLPEISGLE
1p6qA           MSLAEKI-KVLIVDDQVTSRLLLGDALQQLGF-KQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLG
1dcfA           --------KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEE---CLRVVSHEHKVVFMDVCMPGVENYQ
2b4aA1          -------FRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSG-SAFFQHRSQLSTCDLLIVSDQLVDLSIFS
1cb7A           MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVIGVLSPQELFIKAAIETKADAILVSSLYGQGEIDC
1l5yA           --------SVFLIDDDRDLRKAMQQTLELAGFTVSS--FASATEALAGLSADFAGIVISDIRMPGMDGLA
1s8nA           --------RVLIAEDEALIRMDLAEMLREEGYEIVGE-AGDGQEAVELAELHKPDLVIMDVKMPRRD---
1bmtA2          --------KMVIATVKGDVKNIVGVVLQCNNYEIVGVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMV
1w25A2          --------RVLIVDDNERQAQRVAAELGVEHRPV----IESDPEKAKISAGGPVDLVIVNAAAKNFDGLR
2nx2A1          --------VLAITG---YKPFELGIFKQDDKALYYI--KKAIKNRLIAFLDEGLEWILISGQLGVELWAA


                         .         .         *         .         .         .         .:140
query           AAQILLQSEKDISLIIVVDEKTDSDDIDEMYVAGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMV
2basA1          ----------------------------------------------------------------------
1w25A3          ----------------------------------------------------------------------
1tufA2          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2axtC1          ---------------------------------------------------------------AMTFLIR
1wc0A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
1d06A           --------------------------------------------------------------HMLETEDV
2veaA3          ---------------------------------------------------------------SDQSLRQ
1d7eA           ---------------------------------------------------------------AFGSEDI
1a04A2          TLDKLREKSLSGRIVVFSV-SNHEEDVVTALKRGADGYLLKMEPEDLLKALHQAAAGEMVLSEALTPVLA
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           VLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKFDMENLAHHIRQVY---------------
1a0oA           LLKTIRADGAMSALVLMVTAEAKKENIIAAAQAGASGYVVKFTAATLEEKLNKIFEKL------------
1a2oA1          FLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTK--PQLGIREGMLAYSEMIAEKVRTAAR--
1oxbB           STKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKIKRPKLKTILTE-----------------
1f51E           ILKRMKVIDENIR-VIIMTAYGELDMIQESKELGALTHFAKFDIDEIRDAVKKYLP--------------
1b00A           FIKHLKRESMTRDIPVMLTARGEEEDRVRGLETGADDYITKFSPKELVARIKAVMR--------------
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          ILKWIKERSPETEVIVITG-HGTIKTAVEAMKMGAYDFLTK--PCMLEEIELTINKAIEHRKLRKENELL
1d5wA           LLRNLGDLKINIPSIVITG-HGDVPMAVEAMKAGAVDFIEKFEDTVIIEAIERASE--------------
1tmyA           AIKEIMKIDPNAKIIVCSA-MGQQAMVIEAIKAGAKDFIVKFQPSRVVEALNK-----------------
1bywA           ----------------------------------------------------------------------
1p2fA2          ICRXIKETRPE-TWVILLTLLSDDESVLKGFEAGADDYVTKFNPEILLARVKRFLE--------------
1tu1A           LHKRWDINIHGHAAVLLQREGRDLMLRQVFIERRPAVLITTTTTPADLPHHEPAWK--------------
1vm6A2          ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           LAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKRNLKDLFKXVQGIESFWLETVTLPAA---
1g28A           ----------------------------------------------------------------------
1m5tA           VTKWLKEDDDLAHIPVVAVTFAMKGDEERIREGGCEAYISKISVVHFLETIKRLLE--------------
1p6qA           LLQAVRANPATKKAFIILTAQGDRALVQKAAALGANNVLAKFTIEKMKAAIEAVF-----GALK------
1dcfA           IALRIHEKFTQRPLLVALSGNTDKSTKEKCMSFGLDGVLLK--PVSLDNIRDVLSDLLEPRVLY------
2b4aA1          LLDIVKEQTKQPSVLIL------TTGRLIESSEHNLSYLQKFAISELRAAIDYHK---------------
1cb7A           KGLRQKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPTPPEVGIADLKKDLN--------------
1l5yA           LFRKILALDPDLPMILVTG-HGDIPMAVQAIQDGAYDFIAKPFAASARRAEKKRRLVMENRSLRRAAE--
1s8nA           ----------------------------------------------------------------------
1bmtA2          NVAKEMERQGFLLIGGATTSKAHTAVKIEQNYSGPTVYVQNSRTVGVVAALLSDTQRDDFVARTRKEYET
1w25A2          FTAALRSEERTRQLPVLAMDPDDRGRMVKALEIGVNDILSR--PIDPQELSARVKTQIQRKRYTDY----
2nx2A1          EAAYDLQEEYPDLKVAVITPFYEQEKNWKEPNKEQYE---------------------------------


                         +         .         .         .         .         *         .:210
query           LGESERQVRALLESSRDAVGYVHEGMHIYANRAYLELFGYHELDEIEGMPLLDMIAPEEHNRFKAFLKEY
2basA1          ----------------------------------------------------------------------
1w25A3          ----------------------------------------------------------------------
1tufA2          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2axtC1          DQKLGANVGSAQGPTGLGK-YLMPTGEIIFGGETMRFWDFRG-PWLEPLRGPNGLDLNKIKNERRAAEYM
1wc0A           ----------------------------------------------------------------------
1s66L           ---ADGIFFPALEQNMMGAVLINEDEVMFFNPAAEKLWGYKR-EEVIGNNI-DMLIPRDHPEYIRHNREG
1d06A           VRARDAHLRSILDTVPDATVVSTDGTIVSFNAAAVRQFGYAE-EEVIGQNLRILMPEPYRHEHDGYLQRT
2veaA3          LETLAIHTAHLIQPHGLVVVLQPDLTISQISANCTGILGRSP-EDLLGRTLGEVFDSFLTAGQISSLNPS
1d7eA           ENTLAKMDDGQLDGLAFGAIQLGDGNILQYNAAEGDITGRDP-KQVIGKNFFKDVAPCTDSPEFYGKFKE
1a04A2          A---------------------------------------------------------------------
3c2wA3          --EDEPIHVPGAIQPHGALVTLADGMVLAASENIQALLGFVA-SPG-SYLTQEQVGPEVLRMLEEGLTGN
1ll8A           ---------AMDPEFNKAIFTVDTTEILVANDKACGLLGYSS-QDLIGQKLTQFFLRSDSDVVEALSEEA
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           -----------------------TGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYAQLFQE
2oolA2          CDREPIHIPGAIQPHGYLFVVSTDLRIASVSANVEDLLRQPP-ASLLNVPIAHYLTAASAARLTHALHGA
1ny5A1          RREKD-----------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ---------------------------IYCNDGFCELCGYSR-AEVMQRPCCDFLHGPCTQRRAAAQIAQ
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          ----------------------------------------------------------------------
1p97A           ------------MDSKTFLSRHMDMKFTYCDDRITELIGYHP-EELLGRSAYEFYHALDSENMTK-SHQN
2fi0A1          --------NIIDVSIPVAEVVDKEVLEILVELGFKPLANPLM-RNTVGRKVSLKQGSKLAGTPMDKIVRT
1i3cA           ----------------------------------------------------------------------
1g28A           -----------------------DNPIIFASDRFLELTEYTR-EEVLGNNCRFLQGRGTDRKAVQLIRDA
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          V---------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GASEGKSAHFTLRAHKADGHTFTAAWEFTPASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRxxLTGFFS
2basA1          ----------------------------------------------------------------------
1w25A3          ----------------------------------------------------------------LTGLHN
1tufA2          ----------------------------------------------------------------------
3byqA1          ----------------------------------------------------------------LIEIRK
1azsA           ----------------------------------------------------------------------
2axtC1          THAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHRAAAAGFEKGIDRESEP--------
1wc0A           ----------------------------------------------------------------------
1s66L           GKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS-----------------------
1d06A           GEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLT-----------------------
2veaA3          ARVMDFVIFDGVFHRNSDGLLV---CELEP----------------------------------------
1d7eA           GVASGNLNTMFEYTFDYQMTPTKVKVHMKKAL--------------------------------------
1a04A2          ----------------------------------------------------------------------
3c2wA3          GPTRIGEHLFDVIGHSYKEVFY---LEFEIR---------------------------------------
1ll8A           DGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCC-VVVLEPV-----------------------
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           VMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPMQPFIMGIIDRE-------------------------
2oolA2          INPPDGERAFNGILHRHDSIVI---LELEP----------------------------------------
1ny5A1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ALLGAEERKVEIAFYRKDGSCFLCLVDVVP----------------------------------------
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          ----------------------------------------------------------------------
1p97A           LCTKGQVVSGQYRMLAKHGGYVWLETQGTV----------------------------------------
2fi0A1          LEANG-----------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1g28A           -VKEQRDVTVQVLNYTKGGRAFWNLFHLQV----------------------------------------
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
2basA1          ----------------------------------------------------------------------
1w25A3          RRYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDLPCRYGG
1tufA2          ----------------------------------------------------------------------
3byqA1          RTLIVETTYHEASCAVIRNPYAGRYEPDLXPFXAELRSLGTLLATELVDTLGKDNIEVYSKAAIVGVDGE
1azsA           --------------YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAEHCLRIKILG
2axtC1          ----------------------------------------------------------------------
1wc0A           --------------MRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFEQGTVDKFVG
1s66L           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
2basA1          ----------------------------------------------------------------------
1w25A3          EEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTISIGVSATAGEGDEALLKRADEGVYQA
1tufA2          --------------EEQIKINYNRYIEA----FKRWEEETGKE---------FIVAYAYXANANLAITRL
3byqA1          XEHGAVWHEAGGWAXRSVLGE-----PKAXVPAVKAVATAGYRXXVPVHYIHA---SYVRSHFNSIEIGI
1azsA           DCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVRENMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLAN
2axtC1          ----------------------------------------------------------------------
1wc0A           DAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLF
1s66L           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          ------------------------------------------SIGINVLKRFLSELVKVLEDWDVEIVET
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QEAGGNRIERYRPVIEDLTDQEKIKQWEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
2basA1          --------------------------------DILTNIDDVLPYYQAIFSA--EEQKVYEVLGRILADSE
1w25A3          KASGRNAVVGKAA---------------------------------------------------------
1tufA2          LAKLGCGADVVS------------GGELYIAKLSNVPSK-KIVFNGNCKTK--EEIIMGIEANIRAFNVD
3byqA1          QDAPRPREILFAL---VXGTGARVHARLGGLTKEAVSV--------------------------------
1azsA           HMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERN----AYLKEHSIE---------------------
2axtC1          ----------------------------------------------------------------------
1wc0A           GSQERSDFTAIGPSVNIAARLQEATAP------------NSIMVSAMVAQYV----PDEEIIKREFLELK
1s66L           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          HHRFKKDAPSGTA--ILLESALGKSVPIHSLRVGGVPGD-HVVVFGNIG---------------------
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
2basA1          IQSLGPFFLDAGIPEEYKLEVDNRIIRQA---LDRFLEADSDLLIFXNQDANLLHGESFLELLK-EYEAK
1w25A3          ----------------------------------------------------------------------
1tufA2          SISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKNKFGLDVESGIAMKAIKMALEMEYVNVV
3byqA1          ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2axtC1          ----------------------------------------------------------------------
1wc0A           GIDEPVMTCVIN----------------------------------------------------------
1s66L           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
2basA1          GIELHRFVLEITEHNFEGDIEQLYHXLAYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKIDLQA----
1w25A3          ----------------------------------------------------------------------
1tufA2          GVHCHIGSQLTDISPFIEETRKVMDFVVELKEEGIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTM
3byqA1          ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2axtC1          ----------------------------------------------------------------------
1wc0A           ----------------------------------------------------------------------
1s66L           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
2veaA3          ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
3c2wA3          ----------------------------------------------------------------------
1ll8A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1oj5A           ----------------------------------------------------------------------
2oolA2          ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1vm6A2          ----------------------------------------------------------------------
1p97A           ----------------------------------------------------------------------
2fi0A1          ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1g28A           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPxxxxxxxxxxxx
2basA1          LKSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSP------------
1w25A3          ------------------------------------------------------------------
1tufA2          LKYKDKVEMPNLILEPGR------------------------------------------------
3byqA1          ------------------------------------------------------------------
1azsA           ------------------------------------------------------------------
2axtC1          ------------------------------------------------------------------
1wc0A           ------------------------------------------------------------------
1s66L           ------------------------------------------------------------------
1d06A           ------------------------------------------------------------------
2veaA3          ------------------------------------------------------------------
1d7eA           ------------------------------------------------------------------
1a04A2          ------------------------------------------------------------------
3c2wA3          ------------------------------------------------------------------
1ll8A           ------------------------------------------------------------------
1dz3A           ------------------------------------------------------------------
1a0oA           ------------------------------------------------------------------
1a2oA1          ------------------------------------------------------------------
1oxbB           ------------------------------------------------------------------
1f51E           ------------------------------------------------------------------
1b00A           ------------------------------------------------------------------
1oj5A           ------------------------------------------------------------------
2oolA2          ------------------------------------------------------------------
1ny5A1          ------------------------------------------------------------------
1d5wA           ------------------------------------------------------------------
1tmyA           ------------------------------------------------------------------
1bywA           ------------------------------------------------------------------
1p2fA2          ------------------------------------------------------------------
1tu1A           ------------------------------------------------------------------
1vm6A2          ------------------------------------------------------------------
1p97A           ------------------------------------------------------------------
2fi0A1          ------------------------------------------------------------------
1i3cA           ------------------------------------------------------------------
1g28A           ------------------------------------------------------------------
1m5tA           ------------------------------------------------------------------
1p6qA           ------------------------------------------------------------------
1dcfA           ------------------------------------------------------------------
2b4aA1          ------------------------------------------------------------------
1cb7A           ------------------------------------------------------------------
1l5yA           ------------------------------------------------------------------
1s8nA           ------------------------------------------------------------------
1bmtA2          ------------------------------------------------------------------
1w25A2          ------------------------------------------------------------------
2nx2A1          ------------------------------------------------------------------