[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56915.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ou5A1.bssp"
#ERROR : Can't open dsspfile "1ou5A2.bssp"
#ERROR : Can't open dsspfile "1mivA2.bssp"
#ERROR : Can't open dsspfile "1vfgA1.bssp"
#ERROR : Can't open dsspfile "1vfgA2.bssp"
#ERROR : Can't open dsspfile "1mivA1.bssp"
#ERROR : Can't open dsspfile "2paqA1.bssp"

## Summary of PDB Search
:406
    4e-26  14%  1ou5A1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:151 -- 354
    7e-26  27%  1ou5A2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:-1 -- 150
    2e-23  37%  1mivA2 [d.218.1.4] TRNA CCA-ADDING ENZYME A:1 -- 139
    9e-22  24%  1vfgA1 [a.173.1.1] POLY A POLYMERASE A:137 -- 351
    3e-12  29%  1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
    2e-07  28%  1mivA1 [a.173.1.1] TRNA CCA-ADDING ENZYME A:140 -- 404
    6e-05  11%  2paqA1 [a.211.1.1] 5'-DEOXYNUCLEOTIDASE YFBR A:2 -- 187
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYALARTERKTGPG
1ou5A1          ----------------------------------------------------------------------
1ou5A2          HELRIAGGAVRDLLNGVKPQDIDFATTAT--PTQMKEMFQSAG--IRMINNRGEKHGTITARLHEENFEI
1mivA2          -DAYFVGGAVRDLLLGRPIGDVD-IATSALPEDVXAIFPKTIDVGSKHGTVVVVHKGKAYEVTTFKTDGS
1vfgA1          ----------------------------------------------------------------------
1vfgA2          LRAYIVGGVVRDILLGKEVWDVD-----FVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLE-
1mivA1          ----------------------------------------------------------------------
2paqA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARxILRHVSPAFAEDPVRILXXXX
1ou5A1          -------------------------------------------------FVGHAKQRIQEDYLRILRYFR
1ou5A2          TTLR----IFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKN----------------------
1mivA2          VTFVR-------SLEEDLKRRDFTXNAIAXDEYGTIIDPFGGREAIRR----------------------
1vfgA1          -------------------------------------------------VIRVLHPSFIEDPVRILRALR
1vfgA2          FATARRETVEPASLKEDLIRRDFTINAMSVNLEDYGTDYFGGLRDLKD----------------------
1mivA1          -------------------------------------------------IIRTVGEAFREDALRXXRAVR
2paqA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXKVAPETLALMEAMVTAGEADHLVPERVWRELERALGESYPRRFFEILRACGALARIFPEIECL
1ou5A1          FYGRIVDDHDPETLEAIAEN--AKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANAS
1ou5A2          ----------------------------------------------------------------------
1mivA2          ----------------------------------------------------------------------
1vfgA1          FAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQKL
1vfgA2          ----------------------------------------------------------------------
1mivA1          FVSELGFALAPDTEQAIVQN--APLLAHISVERXTXEXEKLLGGPFAARALPLLAETGLNAYLP------
2paqA1          ------------------------------------------------------------SHFFAHLSRL


                         .         .         .         +         .         .         .:280
query           FGVPQPRRYHPEIDTGIHTLKVLEIAAHLSSDTQVRFAALTHDLGKGQTPSHEWPHHYGHGERGVALVLT
1ou5A1          LEEFD--KVSKNVDGFSPKPVTLLASLFKVQDDVTKL----DLRLKIAKEEKNLGLFIVKNRKDLIKATD
1ou5A2          ----------------------------------------------------------------------
1mivA2          ----------------------------------------------------------------------
1vfgA1          YALRKVVDWHARIDYGWLYLLIL-------------ISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLS
1vfgA2          ----------------------------------------------------------------------
1mivA1          ----------------------------------------------------------------------
2paqA1          KLINRLXRNVRTENVSEHSLQVKNRKFGGNVNAEIALLAXYHDASEVLTGDLPTPQEYKAIE--------


                         .         *         .         .         .         .         +:350
query           LCQRLRVPKAYQALAVQVARYHNLVHQAQELRPGTILKLLNRVDAFRRPSRFEQFLLACEADARGRSGLE
1ou5A1          SSDPLKPYQDFII----DSREPDATTRVCELLYQGEHCLLKEMQQ-------------------------
1ou5A2          ----------------------------------------------------------------------
1mivA2          ----------------------------------------------------------------------
1vfgA1          LKEELKKAKENYEVYRLLKPLH------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
1mivA1          ----------------------------------------------------------------------
2paqA1          KIAQQKLVDXVPEELRDIFAPLIDEHAYSDE-EKSLVKQADALCAYLKCLEELAANNEFLLAKTRLEATL


                         .         .         .         .         *         .         .:420
query           NRPYPQANQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ou5A1          --------------------------------------------------------
1ou5A2          --------------------------------------------------------
1mivA2          --------------------------------------------------------
1vfgA1          --------------------------------------------------------
1vfgA2          --------------------------------------------------------
1mivA1          --------------------------------------------------------
2paqA1          EARRSQEXD-----------------------------------------------