[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA56917.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uzbA.bssp"
#ERROR : Can't open dsspfile "1euhA.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "1ky8A.bssp"
#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "1eyyA.bssp"
#ERROR : Can't open dsspfile "1o20A.bssp"
#ERROR : Can't open dsspfile "1k75A.bssp"
#ERROR : Can't open dsspfile "2p4xA1.bssp"
#ERROR : Can't open dsspfile "1i6vC.bssp"
#ERROR : Can't open dsspfile "1xrhA.bssp"
#ERROR : Can't open dsspfile "1at3A.bssp"
#ERROR : Can't open dsspfile "1efpA1.bssp"
#ERROR : Can't open dsspfile "2qi2A2.bssp"
#ERROR : Can't open dsspfile "1s7iA.bssp"
#ERROR : Can't open dsspfile "2b5dX1.bssp"
#ERROR : Can't open dsspfile "1vluA.bssp"

## Summary of PDB Search
:454
    3e-88  28%  1uzbA  [c.82.1.1] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    4e-88  30%  1euhA  [c.82.1.1] NADP DEPENDENT NON PHOSPHORYLATING
    2e-86  30%  1a4sA  [c.82.1.1] BETAINE ALDEHYDE DEHYDROGENASE
    4e-83  25%  1ky8A  [c.82.1.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    2e-78  24%  1ad3A  [c.82.1.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    4e-71  18%  1eyyA  [c.82.1.1] ALDEHYDE DEHYDROGENASE
    4e-58  21%  1o20A  [c.82.1.1] GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
    3e-55  14%  1k75A  [c.82.1.2] L-HISTIDINOL DEHYDROGENASE
    3e-34  15%  2p4xA1 [d.381.1.1] ATP12 ATPASE A:6 -- 238
    3e-26  12%  1i6vC  [e.29.1.1] DNA-DIRECTED RNA POLYMERASE
    4e-25  13%  1xrhA  [c.122.1.1] UREIDOGLYCOLATE DEHYDROGENASE
    8e-22  13%  1at3A  [b.57.1.1] HERPES SIMPLEX VIRUS TYPE II PROTEASE
    3e-18   9%  1efpA1 [c.26.2.3] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN) A:2 --
    3e-17  10%  2qi2A2 [c.55.4.2] CELL DIVISION PROTEIN PELOTA RELATED PROTEIN
    2e-14  10%  1s7iA  [d.58.4.9] HYPOTHETICAL PROTEIN PA1349
    1e-12  11%  2b5dX1 [a.8.3.3] ALPHA-AMYLASE X:415 -- 528
    2e-10  20%  1vluA  [c.82.1.1] GAMMA-GLUTAMYL PHOSPHATE REDUCTASE
:454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
1uzbA           --MVSLNPAPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSRLLLKAAALMRRRKRELEATLV
1euhA           --IKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILS
1a4sA           --EPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEV
1ky8A           --IEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRWARDMPGTERLAVLRKAADIIERNLDVFAEVLV
1ad3A           -----------------------SISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALA
1eyyA           --FYATNAFTGEALLAFPVHTEVEVNQAATAAAKVARDFRRLNNSKRASLLRTIASELEARSDDIIARAH
1o20A           ------------------------LLEKAKKVREAWDVLRNATTREKNKAIKKIAEKLDERRKEILEANR
1k75A           ----------------------------------TIIDWNSCTAEQQRQLLXRPAISASESITRTVNDIL
2p4xA1          ----------------------------------------------------------------------
1i6vC           ----------------------------------------------------------------------
1xrhA           ----------------------------------------------------------------------
1at3A           ----------------------------------------------------------------------
1efpA1          ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1s7iA           ----------------------------------------------------------------------
2b5dX1          -----------------------MIERMIDLSKKYYNSSDPLVERVLNQMLREL---FLAQSSDWAFIMT
1vluA           -----------------------------KNARKAGNILKTISNEGRSDILYKIHDALKANAHAIANKID


                         .         .         *         .         .         .         .:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
1uzbA           YEVGKNWVEASADVAEAIDFIEYYARAALRYRAVEVVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGM
1euhA           KEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEIAVVRREPVGLVLAISPFNYPVNLAGSK
1a4sA           INNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWK
1ky8A           MNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDWTYEGLVRREPLGVVAAITPFNYPLFDAVNK
1ad3A           SDLGKNEWTSYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQDLYIHSEPLGVVLVIGAWNYPFNLTIQP
1eyyA           LETALPEVRLTGEIARTANQLRLFADVVNSGSYHQAAPLPKPDIRRQQIALGPVAVFGASNFPLSAAGGD
1o20A           IDVEKALALNDKRIDEXIKACETVIGLKDPVVIDSWVREDGLRIARVRVPIGPIGIIYESRPNVT--VET
1k75A           DNVKARGDEALREY---SAKFDKTTVTALKVSAEEIAAASERLSDELKQAAVAVKNIETFHTAQKLPPVD
2p4xA1          -------------------------EWKARRFWASVGIHK--EEGGWAVLLDERPLRTPGKQPLRLPTEA
1i6vC           -EDRYTIAQANTPLEGDRIATDRVVARRRGEPVIVAPEEVEFMDVSPKQVFSLNTNLIPFLEHDDANRAL
1xrhA           ----------------------------------------------------------------------
1at3A           ------------------------------------------------VPIYVALYDSGDPGELALDPDT
1efpA1          ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1s7iA           ----------------------------------------------------------------------
2b5dX1          TRTSVQYAENRTKLHIKR-FLNLYDQLVSGRIDEEMLRYYEWTDAI-------FPEINFRVMA-------
1vluA           LAVAKETGLADSLLKRL------------DLFKGDKFEVXLQKDVAELEPVGVLLVIFESRPEV--IANI


                         +         .         .         .         .         *         .:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
1uzbA           IVGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGEEVGAYLEHPRIRFINFTGSLEV
1euhA           IAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSEIGDYIVHQAVNFINFTGSTGI
1a4sA           CAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPT
1ky8A           ITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPGKEAEKIVADDRVAAVSFTGSTEV
1ad3A           MVGAVAAGNAVILKPSEVSGHMADLLAT-LIPQYMDQNLY-LVVKGGVPETTELLKERFDHIMYTGSTAV
1eyyA           TASALAAGCPVIVKGHTAHPGTSQIIEQALKQEQLPQAIFTLLQGNQRALGQALVHPEIKAVGFTGSVGG
1o20A           TILALKSGNTILLRGGSDALNSNKAIREALKETEIPESSV--EFIENTDRSLVLEXIRLREYLSLVIPRG
1k75A           VETQPGVRCQQVTRPVASVGLYIPGGS-----APLFSTVLXLATPAS--------IAGCKKVVLCSPPPI
2p4xA1          LALAIAEAVQEVIDPN-AMPLTRSANSAIEKVAPQFDAVAAMLGDYDLLSYRADAPEALVRAQAEGWDPL
1i6vC           MGSNIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVVKVDAVRYEDGRLVHPLRRYARSNQGTAFDQRP-
1xrhA           ----------------------------------------------------------------------
1at3A           VRAALPPENPLPINVDHRARCEVGRVLAVVNDPRGPFFVGLIACVQLERSVSLSTKPDRTLFAHVALCAI
1efpA1          -----------------------------------VAEDALYGHRLAEPTAALIGLAGDYSHIAAPATTD
2qi2A2          ----------------------------------------------------------------------
1s7iA           ----------------------------------------------------------------------
2b5dX1          ----------------------------------------------------------------------
1vluA           TALSIKSGNAAILKVNTFREXAKITIAQFQSETGVPVGSVQ--LIETRVSDLLDQDEYIDLVVPRGSNAL


                         .         .         .         +         .         .         .:280
query           GRKVAECAGRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIA
1uzbA           GLKIYEAAGTWFKRAYVETGGKNAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLE
1euhA           GERIGKMA--GMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVE
1a4sA           GKKVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLE
1ky8A           GERVVKVGG--VKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAGQRCDAIKLVLAERPVYGKLVE
1ad3A           GKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVE
1eyyA           GRALFNLAHERPEPFYGELGAINPTFIFPSAMRAKADLAFVASMTMGCGQFCTKPGVVFALNTPETQAFI
1o20A           GYGLISFVRDNATVPVLETGVGNCHIVDESADLKKAVPVIINAKTQRPGT-CNAAEKLLVHEKIAKEFLP
1k75A           ADEILYAAQLCGVQDVFNVGGAQAIAALAFGTESVPK----VDKIFGPGNAFVTEAKRQVSQRLDGAAID
2p4xA1          IDWAATELRAPLRITHGVIPVPQDPVVLLKLRAEVASLDPFGLDLVTLPGSLILGLAVIRGRIDAPTAHS
1i6vC           ------RVRVGQRVKKGDLLADGPASEEGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHI
1xrhA           -------------------------------------------------------------SKISRETLH
1at3A           GRRLGTIVDTSLDAAIAPFRHLDP----------------------------------------------
1efpA1          AKNVMPRVAALLDVERPIYAGNAIQVVKSKDAKKVFIRTASFDAAGEGGTAPVTETAAAADPGLSSWVAD
2qi2A2          ----------------------VTVYTAVAMDEDEAQIFLIHGIQQVGTVYSGRSGKYYSEASYFDQIVN
1s7iA           ---------------------------------------------------------------LYFQGNM
2b5dX1          ----------------------------------------------------------------------
1vluA           VRKIKDTTK---IPVLGHADGICSIYLDEDADLIKAKRIS-----LDAKTNCNAXETLLINPKFSKWWEV


                         .         *         .         .         .         .         +:350
query           RFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQ
1uzbA           RVLKRAERLSVGPAEE-NPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGGK-RLEGEGYFIAPTVFTEVP
1euhA           KIREKVLALTIGNPED-DADITPLIDTKSADYVEGLINDANDKGATALTEIKR---EGNLICPILFDKVT
1a4sA           EVVKRTKAIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGEPKLKNGYFMSPCVLDNCR
1ky8A           EVAKRLSSLRVGDPRDPTVDVGPLISPSAVDEMMAAIEDAVEKGGRVLAGGRRLGPTVQPTLVEAPADRV
1ad3A           KLKKSLKDF-YGEDAKQSRDYGRII----NDRHFQRVKGLIDNQKVAHGGT--WDQSSRYIAPTILVDVD
1eyyA           ET-----AQSLIRQQSPSTLLTPGIR-------DSYQSQVVSRGSDDGIDVTFSQAESPCVASALFVTSS
1o20A           VIVEELRKHGVEVRGCEKT---------------------------------------REIVPDVVPATE
1k75A           XPAGPSEVLVIADSGATPDFVASD--------LLSQAEHGPDSQVILLTPAADXARRVAEAVERQLAELP
2p4xA1          RIDEEFQAERWGRD--------------------------------------------------------
1i6vC           ER-YEIEARDTKLGPERITRDIPHLSEAALRDLDEEGI--VRIGAEVKPG-DILVG---RTSFKGEQEPS
1xrhA           QLIENKL-CQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGT----NREPEFRLEETGP
1at3A           ----------------------------------------------------------------------
1efpA1          EV--------------------------------------------------------------------
2qi2A2          ALKNYSNSIIILGPGFARDRFARYCAQRGVNVIGSFPANRTDSGAV------------------------
1s7iA           KY-----LCLIYFDEAKLAAVPAEELAAIVDECMTYSDQLGKAGHYIASHALQSVQTATTLRHQGGRLAM
2b5dX1          ----------------------------------------------------------------------
1vluA           LENLTLEG--------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PGMPAFDEELFGPVAAIIRXXXXXXXXXXXXXSRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD
1uzbA           PKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGV
1euhA           TDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNTQRGT
1a4sA           DDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVAANLEAGTCYINTYSISP
1ky8A           KDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAVRLLEVGAIYINMPRHGI
1ad3A           PQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVIKKMIAETSSGGVTANDVIITV
1eyyA           ENWRKWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYPQVPRLEEIAGRLVFNGVEVGY
1o20A           DDWP---TEYLDLIIAIKVVKNVDEAIEHIKKYSTGHSESILTENYSNAKKFVSEIDAAAVYVNASTRFT
1k75A           RAETARQALNASRLIVTKD----LAQCVEISNQYGPEHLIIQTRN--ARELVDSITSAGSVFLGDWSPES
2p4xA1          ----------------------------------------------------------------------
1i6vC           PEE-RLLRSIFGEKARDVK---------------------------------------------------
1xrhA           CSAILHADNAAGQVAAKXGXEHAIKTAQQN---GVAVVGISRXGHSGAISYVQQAARAGFIGISXCQSDP
1at3A           ----------------------------------------------------------------------
1efpA1          ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1s7iA           TDGPFAKEQLGGFY--LIEARDLNQALQIAAKIPPGRLGCVEVRPVKEWE--------------------
2b5dX1          ----------------------------------------------------------------------
1vluA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PRLPFGGIKCSGYGRELSWHGMREFTNQKTLWIK
1uzbA           GVQPFGGFKLSGTNAKTALDYLRLFLEMKAVAER
1euhA           DNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFD
1a4sA           VEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVE
1ky8A           GYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFN
1ad3A           PTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK
1eyyA           AMVHGGPYPASTHSASTSVEAIHRWLRPVAYQAL
1o20A           DGGQFGFGAEIGISTARGPVGLRELTTYKFVVLG
1k75A           AGDYASGTNHYGYTATCSSLGLADFQKRXTVQE-
2p4xA1          ----------------------------------
1i6vC           ----------------------------------
1xrhA           XVVPFGG-AEIYYGTNPLAFAAPGEGDEILTFD-
1at3A           ----------------------------------
1efpA1          ----------------------------------
2qi2A2          ----------------------------------
1s7iA           ----------------------------------
2b5dX1          ----------------------------------
1vluA           ----------------------------------