[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57113.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g5bA.bssp"
#ERROR : Can't open dsspfile "1nnwA.bssp"
#ERROR : Can't open dsspfile "1su1A.bssp"
#ERROR : Can't open dsspfile "1kbpA2.bssp"
#ERROR : Can't open dsspfile "1auiA.bssp"
#ERROR : Can't open dsspfile "1xm7A.bssp"
#ERROR : Can't open dsspfile "1w24A1.bssp"
#ERROR : Can't open dsspfile "1t71A.bssp"
#ERROR : Can't open dsspfile "1t70A.bssp"
#ERROR : Can't open dsspfile "1ii7A.bssp"
#ERROR : Can't open dsspfile "1s3lA.bssp"

## Summary of PDB Search
:228
    5e-19  32%  1g5bA  [d.159.1.3] SERINE/THREONINE PROTEIN PHOSPHATASE
    3e-13  14%  1nnwA  [d.159.1.5] HYPOTHETICAL PROTEIN
    1e-11  13%  1su1A  [d.159.1.7] HYPOTHETICAL PROTEIN YFCE
    1e-09  11%  1kbpA2 [d.159.1.1] PURPLE ACID PHOSPHATASE A:121 -- 432
    1e-06  20%  1auiA  [d.159.1.3] SERINE/THREONINE PHOSPHATASE 2B
    4e-06  16%  1xm7A  [d.159.1.8] HYPOTHETICAL PROTEIN AQ_1665
    6e-06  15%  1w24A1 [d.159.1.7] VACUOLAR PROTEIN SORTING PROTEIN 29 A:1 -- 181
    2e-05  11%  1t71A  [d.159.1.9] PHOSPHATASE
    1e-04   9%  1t70A  [d.159.1.9] PHOSPHATASE
    2e-04  20%  1ii7A  [d.159.1.4] MRE11 NUCLEASE
    8e-04  21%  1s3lA  [d.159.1.7] HYPOTHETICAL PROTEIN MJ0936
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxRFSKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLEYPWFHS
1g5bA           ------------NIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRA
1nnwA           --------------AVLANIAGNLPALTAALSRIEEMREEEKYYILGNIVGLFPYPKEVIEVIKKENVKI
1su1A           ------------KLMFASDIHGSLPATERVLELFAQ-SGAQWLVILGDVLNHGPRNALPEGYAPAKVVER
1kbpA2          ----QTGLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFT
1auiA           ----------------CGDIHGQFFDLMKLFEVGGSPA-NTRYLFLGDYVDRGYFSIECVLYLYPKTLFL
1xm7A           ---------------LNPEVRFKGFEIVILTNLLKVLKPEDTLYHLGDFTWHFNDKNEYLRIWKAGRKIL
1w24A1          --------------LVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHI-
1t71A           ---------------FLGDVYGGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHEFLKEAGVNY
1t70A           --------------LFIGDVFGQPGRLQNHLPTIRPQFD-FVIVNMENSAGGFGMHRDAARGALEAGAGC
1ii7A           --------------AHLADIHLGYEQFHKPQREEEFAEAFKNALEIGDLFHSSRPSPGTLKKAIALLVFA
1s3lA           ---------------IMSDTHDHLPNIRKAIEIFN-DENVETVIHCGDFVS--LFVIKEFENLNAN-IIA


                         .         .         *         .         .         .         .:140
query           CRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLPFAMEIETDQGKVGIVHADVP
1g5bA           VRGNHEQMMIDGLSERGNVNHW-LLNGGGWFFNLDYDKEILLAHKADELPLIIELVSKDKKYVICHADYP
1nnwA           IRGKYDQSDPHATDPGYIDKLELPGHVKKALKFTWEKLGHEGREYLRDLPIYLVDKIGGNEVFGVYGSPI
1su1A           LNEVAHKVIACDSEVDQMLLHFPITAPWQQVLLEKQRLFLTHGHLFGPENLPALNQNDVLVYGHTHLPVA
1kbpA2          ERSVAYPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKR---------------
1auiA           LRGNHECRHLTEYF-------------TFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLS
1xm7A           VMGNHDESLKEYFDEIYDFYKIIEHKGKRILL--------------------------------------
1w24A1          VRGDFDENLNYPEQKVVTVGQFKIGLIHGHQ---------------------------------------
1t71A           ITMGNHTWFQKLDLAVVINKKDLVRPLN----------LDTSFAFHNLGQGSLVFEFNKAKIRITNLLGT
1t70A           LTLGNHAWHHKDIYPMLSEDTYPIVRPLNYA---------------------------------------
1ii7A           IEGNHDRTQRGPSVLNLLEDFGLVYVIGMRK---------------------------------------
1s3lA           TYGNND----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEGIERVYCGHTVIKGGTLKIVGNVYFIDTGAA
1g5bA           FDEYE-----FGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVK--PLKFANQMYIDTGAV
1nnwA           NPFDGEVLAEQPTSYYEAIMR---------------PVKDYEMLIVASPMYPV--DAMTRYGRVVCPGSV
1su1A           EQRGEIFHF------NPGSVSIPKGGNPASYGMLDNDVLSVIALNDQSI---------------------
1kbpA2          ----------------------------------------------------------------------
1auiA           PEINTLDDIRKLDR--------------------------------------------------------
1xm7A           ----------------------------------------------------------------------
1w24A1          ----------------------------------------------------------------------
1t71A           SVPLPFKTTNPFKDCDLHIVDFHAETTSEKNAFCMAFDGYVTTIFGTHTHVPSADLRITGSAYITDVG--
1t70A           ----------------------------------------------------------------------
1ii7A           ----------------------------------------------------------------------
1s3lA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YTFLGARLTLLxxxxxxx
1g5bA           F---CGNLTLI-------
1nnwA           G-----------------
1su1A           ------------------
1kbpA2          ------------------
1auiA           ------------------
1xm7A           ------------------
1w24A1          ------------------
1t71A           ------------------
1t70A           ------------------
1ii7A           ------------------
1s3lA           ------------------