[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57133.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpmA2.bssp"
#ERROR : Can't open dsspfile "1a9xB2.bssp"
#ERROR : Can't open dsspfile "1gpmA1.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "2ghrA1.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1o1yA.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1jgtA1.bssp"
#ERROR : Can't open dsspfile "1gpmA3.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "1q15A1.bssp"
#ERROR : Can't open dsspfile "1xngA1.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "2c5sA1.bssp"
#ERROR : Can't open dsspfile "1fy2A.bssp"
#ERROR : Can't open dsspfile "1ni5A1.bssp"
#ERROR : Can't open dsspfile "1k92A1.bssp"
#ERROR : Can't open dsspfile "1wy5A1.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1ee1A.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1vbkA1.bssp"
#ERROR : Can't open dsspfile "1xr4A2.bssp"
#ERROR : Can't open dsspfile "1suwA.bssp"
#ERROR : Can't open dsspfile "1sy7A1.bssp"
#ERROR : Can't open dsspfile "1t8hA.bssp"
#ERROR : Can't open dsspfile "1surA.bssp"
#ERROR : Can't open dsspfile "2pg3A1.bssp"
#ERROR : Can't open dsspfile "1j1zA1.bssp"

## Summary of PDB Search
:524
    5e-44  64%  1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
    9e-36  23%  1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
    8e-35  63%  1gpmA1 [c.26.2.1] GMP SYNTHETASE A:208 -- 404
    3e-33  23%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    4e-33  16%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    2e-30  13%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    5e-30  17%  2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
    2e-29  35%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    5e-29  21%  1o1yA  [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
    1e-28  22%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    3e-27  18%  1jgtA1 [c.26.2.1] BETA-LACTAM SYNTHETASE A:210 -- 508
    7e-27  83%  1gpmA3 [d.52.2.1] GMP SYNTHETASE A:405 -- 525
    8e-27  19%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    9e-27  15%  1q15A1 [c.26.2.1] CARA A:206 -- 501
    1e-26  18%  1xngA1 [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE A:3 -- 257
    2e-26  26%  1i1qB  [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
    8e-26  20%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    1e-25  13%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    8e-24  19%  2c5sA1 [c.26.2.6] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII A:174
    2e-23  15%  1fy2A  [c.23.16.4] ASPARTYL DIPEPTIDASE
    9e-23  16%  1ni5A1 [c.26.2.5] PUTATIVE CELL CYCLE PROTEIN MESJ A:0 -- 226
    2e-21  12%  1k92A1 [c.26.2.1] ARGININOSUCCINATE SYNTHASE A:1 -- 188
    1e-18  16%  1wy5A1 [c.26.2.5] HYPOTHETICAL UPF0072 PROTEIN AQ_1887 A:1 -- 216
    7e-18   8%  1aa7A  [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
    8e-13  23%  1ee1A  [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    1e-12  12%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    1e-12   8%  1vbkA1 [c.26.2.6] HYPOTHETICAL PROTEIN PH1313 A:176 -- 307
    7e-12  18%  1xr4A2 [c.124.1.2] PUTATIVE CITRATE LYASE ALPHA CHAIN/CITRATE-ACP
    3e-09  19%  1suwA  [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE
    3e-09  10%  1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
    7e-08  14%  1t8hA  [d.194.1.2] YLMD PROTEIN SEQUENCE HOMOLOGUE
    3e-07  18%  1surA  [c.26.2.2] PAPS REDUCTASE
    2e-06  24%  2pg3A1 [c.26.2.1] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC A:1 -- 230
    8e-04  25%  1j1zA1 [c.26.2.1] ARGININOSUCCINATE SYNTHETASE A:1 -- 165
:524

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDLYAHRILILDFGSQYTQLIARRVREAGVYCEIHPYDMAESTLRDFAPRGIILSGGPASTVGETAPRL
1gpmA2          ------HRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
1a9xB2          -------HVVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPDYAITA
1gpmA1          ----------------------------------------------------------------------
1qdlB           -------LTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDISIKGIERIDPDRLIISPGPGTPEKREDIGV
1jvnA2          -------VVHVIDVESGNLQSLTNAIEHLGYEVQLVKSP-KDFNISG--TSRLILPGVGNYGHFVDNLFN
1l9xA           -------RNKVMKNYGRYYASYVKYLESAGARVVPVRLDLTEKDYEILFINGILFPGGSVDLRRSDYAKV
2ghrA1          -------KIAILNLEAQLLRLIGNTPLQLDVLHXESSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDY
1wl8A1          -------MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKV
1o1yA           -------RVLAIRHVEIEDGXXEDIFREKNWSFDYLDTPGEKLERPLEEYSLVVLLGGYXGAYEEEEFQL
1gpwB           -------RIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESP-RNDLYDLLFIPGVGHFGEGMRRLRE
1jgtA1          ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1q7rA           -------KIGVLGLQGAVREHV-RAIEACGAEAVIVKKSEQL-----EGLDGLVLPGGESTTXRRLIDRL
1q15A1          ----------------------------------------------------------------------
1xngA1          ----------------------------------------------------------------------
1i1qB           -------DILLLDNIDSFTWNLADQLRTNGHNVVIYRNHILIDRLATMKNPVLMLSPGPGVPSEAGCMPE
1ka9H           -------KALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHE-----EADLLVLPGQGHFGQVMRAFQE
1t3tA2          IATGARPKVAVLREGVNSHVEMAAAFHRAGFDAIDVHMSLLGGRIGLGNFHALVACGGFSYGDVLGAGEF
2c5sA1          ----------------------------------------------------------------------
1fy2A           ----------VTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIE-KAEIIIVGGGN-TFQLLKESRE
1ni5A1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1aa7A           -------EDVFAGKNTDLEVLMEWLKTRPILSPLGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKA
1ee1A           ----------------------------------------------------------------------
1j42A           --------MRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1suwA           -------RAAVVYKTDGHVKRIEEALKRLEVEVELFNQP--SEELEN--FDFIVSVGGD-GTILRILQKL
1sy7A1          -------------------LVIGPRRSKVTAANGSTQPHHHLEGFRSTMVDAIFIPGGAKAAENGRALHW
1t8hA           ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1j1zA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPLIFELGVPLLGICYGMQVMAAQLGGRVEVSAQREYGYAQVYVHGHSRLLQNIEDHTTAGGEALLDVWM
1gpmA2          PQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGIEDALTADGKPLLDVWM
1a9xB2          IQKFLETDIPVFGIXLGHQLLALASGAKT--------VKMKFGHHGGNHPVKDVEK------NVVMITAQ
1gpmA1          ----------------------------------------------------------------------
1qdlB           SLDVIKYRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNI-----ILVNNSPLSLYYGIAKEFKATR
1jvnA2          RGFEIESGKPIMGIXVGLQALFAYIDFKLSRFDDSEKPVPE---IGWNSCIP--SENLFFGLDPYKRYYF
1l9xA           AKIFYNLYFPVWGTCLGFEELSLLISGECPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSV
2ghrA1          WEELKRIVTSTLHICWGAQAGLYHHYGVQKYPKEKXFGVFEHEVEQHVKLLQGFDELFFAPHS----RHT
1wl8A1          LEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEEIFKGLPKRLKV---------WE
1o1yA           IEEILKKEIPFLGIXLGSQXLAKVLGASVYRGKNGEIGWYFVEKVSDNKFFREFPDRLR--------VFQ
1gpwB           NDLIVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYF
1jgtA1          ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1q7rA           XEPLAAAGKPXFGTCAGLILLAKRIVGYDEPHLGLXDITVERNSFGRQRESFE-AELSIKGVGDGFVGVF
1q15A1          ----------------------------------------------------------------------
1xngA1          ----------------------------------------------------------------------
1i1qB           LLTRLRGKLPIIGICLGHQAIVEAYGGYV-----------GQILHGKATSIEHDGQAMFAGLANPLPVAR
1ka9H           SGFVLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRH
1t3tA2          ETFFHRPQTLALGVXNGCQMMSNLRELIPGSELWPRFVRNHSDRFEARFSLVEVTQSPSLLLQGMVGVAL
2c5sA1          ----------------------------------------------------------------------
1fy2A           RGLLVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQ---INPHFTNTREQRIRELLVV
1ni5A1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1aa7A           VKLYRKLFHGAKEISLSYSAGALASCMGLIVTTEVAFGLVCATCEQ------------------------
1ee1A           ----------------------------------------------------------------------
1j42A           LKEQENRKGLIAAICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGH---------YTYSENRVEKDGLI
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1suwA           KR-----CPPIFGINTGRV---------------------------------------------------
1sy7A1          IREAFGHLKAIGATGEAVDLVAKAIALPQVTVSSEAEVHESYGVVTLKKVKPESGAAGFLGEFFYAIAQH
1t8hA           -------------------------------------------------------------------VCC
1surA           ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1j1zA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SHGDRVIGLPEGFKRIAATAHAPLAGMADEKRRFYGFQFHPEVTHTRQGIRILERFIYDICGCEALWEPR
1gpmA2          SHGDKVTAIPSDFITVASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEAL----
1a9xB2          NHGFAVATLPANLRVTHKSLDGTLQGIHRTDKPAFSFQGNPEASPGHDAAPLFDHFI-------------
1gpmA1          ------------------------------------------------------------------WTPA
1qdlB           YHSLVVDEVHRPLIVDAISAENEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV----------
1jvnA2          VHSFAAKNLENDGWKIAKAKYGSEFIAAVNKNNIFATQFHPEKSGK-AGLNVIENFLKQQSPPIPNYSAE
1l9xA           KNFTMNEKLKKFFNVLTTNTDEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHA--PNAVKTAFYLA
2ghrA1          EVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDQEYERDRDKGLN------------
1wl8A1          SHMDEVKELPPKFKILARSETXPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFA-KLCG--------
1o1yA           WHGDTF-DLPRRATRVFTSEKYENQGF--VYGKAVGLQFHIEVGA-RTXKRWIEAYKDELEKKKIDPRLL
1gpwB           VHTYRAVCEEEHVLGTTEYDGEI-FPSAVRKGRILGFQFHPEK-SSKIGRKLLEKVI-------------
1jgtA1          ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1q7rA           IRAPHIVEAGDGVD---VLATYNDRIVAARQGQFLGCSFHPELTDDH---RLXQYFLNXVKEAKXAS---
1q15A1          ---------------------------------------------------------------------D
1xngA1          ----------------------------------------------------------------------
1i1qB           YHSSNVPAGL----TINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGARLLEQTL-AWAQQK------
1ka9H           FYFANSYYGPLTPYSLGKGEYEGTFTALLAKENLLAPQFHPEKSGK-AGLAFLALAR-------------
1t3tA2          RYVDNFGKVTETYPANPNGSPNGITAVTTENGRVTIMMPHPERVFRTVA----NSWHPENWGEDSPW---
2c5sA1          ----------------------------------------------------------------------
1fy2A           APELTVIGLPEGNWIQVSNGQA--VLGGPNTTWVFKAGEEAVALEA------------------------
1ni5A1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1wy5A1          ---------------------------------------------------------------------I
1aa7A           ----------------------------------------------------------------------
1ee1A           ----------------------------------------------------MQEKIMRELHVKPSIDPK
1j42A           LTSRGPGTSFEFALAIVEALNGKEVAAQVKAP--------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1sy7A1          RNWDREL---------------------------------------------------------------
1t8hA           EHGADIQKSDRGNGAQDFATAVPGVDGLYTDEA--GVLLALCFADC-VPIYFVAPSAGLVGLAHAGWRAG
1surA           -------------------------------------------------------------------DAE
2pg3A1          ----------------------------------------------------------------------
1j1zA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HIIAKSIENIRTKVGADTVLLGLSGGVDSSVAAALLHKAIGDQLICVFVDNGLLRQGEADQVMATFARHL
1gpmA2          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1gpmA1          KIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHF
1qdlB           ----------------------------------------------------------------------
1jvnA2          EK--ELLMN-------------------------------------------------------------
1l9xA           EFFVNEARKNNHHFKSESEE--------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1o1yA           LETAEREEKVL-----------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1jgtA1          ----------QRVTPGDTPLVVLSGGIDSSGVAACAHRAAGELDTVSMGTDTSNEFREARAV----VDHL
1gpmA3          ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1q15A1          RYLNAPLE--DLAPRFDTVGIPLSGGLDSSLVTALASRHFKKLNTYSIGTELSNEFEFSQQVADALTHHQ
1xngA1          ------LEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSMPENKTDALN-LCEKF
1i1qB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1t3tA2          ---MRIFRNARKQLG-------------------------------------------------------
2c5sA1          ----------------GKVMVLLSGGIDSPVAAYLTMK-RGVSVEAVHFHSPPFTSERAKQKVIDLAQEL
1fy2A           ----------------------------------------------------------------------
1ni5A1          -----TLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWPGVALRAIHVHHGLSANADAWTHCENVCQQW
1k92A1          ----------------QRIGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEEDYDAIPR-RAMEY
1wy5A1          RKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYEVALAHFNHMLRESAERDEFCKEFAKER
1aa7A           ----------------------------------------------------------------------
1ee1A           QEIEDRVNFLKKKTGAKGFVLGISGGQDSTLAGRLAQLAVDAQFIAVRLPHG-TQQDEDD-------AQL
1j42A           ----------------------------------------------------------------------
1vbkA1          ----------------GRMIGILHDELSALAIFLMMKR--GVEVIPVYIGKDDKNLEKVRSLWN-LLKRY
1xr4A2          ------------------TAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNL-RAA
1suwA           ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1t8hA           GIAGHMVWLWQTREHIAPSDIPCCYTVDDRVVDSLRPTLPPESPLPWRETSLDLKEANRLQL-----LAA
1surA           GRVAWALDNL-----PGEYVLSSSFGIQAAVSLHLVNQIRPDIPV-ILTDTGYLFP-ETYRFIDELTDKL
2pg3A1          ------------------AVVVFSGGQDSTTCLIQA-LQDYDDVHCITFDYGQRHRAEIEVAQE-LSQKL
1j1zA1          ------------------IVLAYSGGLDTSIILKWLKETYRAEVIAFTAD---IGQGEEVEEAREKALRT


                         .         *         .         .         .         .         +:350
query           GIKVIHISAETRFLEALAGVIDPEAKRKIIGRVFIEVFEEEAAKLPNAQWLAQGTIYPDVIESAGGKTGK
1gpmA2          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1gpmA1          GLNIVHVPAEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAAK----
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1jgtA1          RTRHREITIPTTELLAQSESVDPDIIEYLLPLTALYRALDGPERRYGADIPLGGMHREDRLPALDTVLAH
1gpmA3          ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1q15A1          MKILSETEVINGIIESIYYNEIFDGLSAEIQSGLFNVYRQAQGQVSGSDLLFGGILKPGAQY-DNPNQLL
1xngA1          SITEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKS---DSLVIGT--SNKSERMLGYGTL
1i1qB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
2c5sA1          TKYCKRVTLHLVPFTEVQKTINKEIPSSYSMTVMRRMITERIAEERNALAITTGESLGQVASQ-------
1fy2A           ----------------------------------------------------------------------
1ni5A1          QVPLVVER-----------VQLAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCETFLLALKR
1k92A1          GAENARKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGLVAAMKEDGVNIWGDGSTYKGNDIERFY----
1wy5A1          NMKIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEI-----LESEGFDCIATAHHLNDLLETSLLFFTR
1aa7A           ----------------------------------------------------------------------
1ee1A           ALKFIKPDKSWKFDIKSTVSAFSDQYQQETG-DQLTDFNKGNVK-ARTRMIAQYAIQEGLLVL--GTDHA
1j42A           ----------------------------------------------------------------------
1vbkA1          SYGSKG----------------------FLVVAESFDRVLKLIRDFGVKGVIKGLRPNDLNS-------E
1xr4A2          GVALXTIEQLQQRAEQLTGKPQPEFTDRVVAVV-------------------------------------
1suwA           ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1t8hA           GVPNSHI---------------------------------------------------------------
1surA           KLNLKVYRATESAAWQEA----------------------------------------------------
2pg3A1          GA-AAHKVLDVGLLNELAT---------------------------------------------------
1j1zA1          GASKAIA---------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQVIKSHHNVGGXXXXXXXXXXXXXXXXFKDEVRQLGTELGLPFELVYRHPFPGPGLGVRILGEVKKEYA
1gpmA2          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1gpmA1          ---MGLVEPLKEL---------------FKDEVRKIGLELGLPYDMLYRHPFP-----------------
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1jgtA1          D--MATFDGLNEMSPVLSTLAGHWTTHPYWDR-EVLDLLVSLEAGLKRRHGRDKWVLRAAMADALPA---
1gpmA3          -----------------------------------------------------GPGLGVRVLGEVKKEYC
1q7rA           ----------------------------------------------------------------------
1q15A1          AEQVYRTRWTGEFATHGASCYGIDIRHPFWSH-SLISLCHALHPDYKIFDNEVKNIL-------------
1xngA1          FGDLACAINP--------------IGELFKTEVYELARRLNIPKKILNKPPSADLFVGQSDEKDLGYPYS
1i1qB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
2c5sA1          -----TLDSMHTINEVTNYPVIRPLITMDKLEIIKIAEEIGTYD---ISIRPYKPKREKANRFEAKYDFT
1fy2A           ----------------------------------------------------------------------
1ni5A1          GSGPAGLSAXAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWDDSYDRNFRWPHFAEATA-----RSA
1k92A1          --RYGLLTNAELQIYKPWLDTDFIDELGGRHEMSEFMIACGFDY--------------------------
1wy5A1          GTGLDGLIG----FLPKEEVIRRPLYYVKRSEIEEYAKFKGLRW--------------------------
1aa7A           ----------------------------------------------------------------------
1ee1A           AEAVTGFFTKYG----DGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEP-------------------
1j42A           ----------------------------------------------------------------------
1vbkA1          VSEITEDFKMFP------VPVYYPLIALPEEYIKSVKERLGL----------------------------
1xr4A2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1t8hA           ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1j1zA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DLLRLADAIFIEELHAHDWYDKVSQAFAVFLPVKSVGVMGDGRCYDFVVALRAVESVDFMTARWAHLPYD
1gpmA2          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1jgtA1          ----------------ETVNRPKLSSFSRL--LLDHGVAEDRVHEAKRQVVRELF--DLTVGGGRHPSEV
1gpmA3          DLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYD
1q7rA           ----------------------------------------------------------------------
1q15A1          ----REYADSLQLLPKDIVWRSVNQAFANVLGSTVDNYQTKSR-FTYRVYQAFLRGRLSITDVTPSQLKD
1xngA1          VIDPLLKDIEALFQTKPIDTETLAQL--------------------------------------------
1i1qB           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
2c5sA1          PLIDEAVANKETMV--------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1ni5A1          ALCAEQES-LLDEL--------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1ee1A           ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1t8hA           ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------
1j1zA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FLDHVSRRIINEVAGISRVTYDISGKPPATIEWE
1gpmA2          ----------------------------------
1a9xB2          ----------------------------------
1gpmA1          ----------------------------------
1qdlB           ----------------------------------
1jvnA2          ----------------------------------
1l9xA           ----------------------------------
2ghrA1          ----------------------------------
1wl8A1          ----------------------------------
1o1yA           ----------------------------------
1gpwB           ----------------------------------
1jgtA1          DTDDVVRSVAD-----------------------
1gpmA3          FLGRVSNRIINEVNGISRVVYDISGKPPATIEWE
1q7rA           ----------------------------------
1q15A1          LI--------------------------------
1xngA1          ----------------------------------
1i1qB           ----------------------------------
1ka9H           ----------------------------------
1t3tA2          ----------------------------------
2c5sA1          ----------------------------------
1fy2A           ----------------------------------
1ni5A1          ----------------------------------
1k92A1          ----------------------------------
1wy5A1          ----------------------------------
1aa7A           ----------------------------------
1ee1A           ----------------------------------
1j42A           ----------------------------------
1vbkA1          ----------------------------------
1xr4A2          ----------------------------------
1suwA           ----------------------------------
1sy7A1          ----------------------------------
1t8hA           ----------------------------------
1surA           ----------------------------------
2pg3A1          ----------------------------------
1j1zA1          ----------------------------------