[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57138.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vk1A.bssp"
#ERROR : Can't open dsspfile "2hwjA1.bssp"
#ERROR : Can't open dsspfile "1vz0A2.bssp"
#ERROR : Can't open dsspfile "1xw3A1.bssp"
#ERROR : Can't open dsspfile "1d6uA3.bssp"

## Summary of PDB Search
:510
    8e-15  12%  1vk1A  [d.268.1.2] CONSERVED HYPOTHETICAL PROTEIN
    2e-12   9%  2hwjA1 [d.268.1.3] HYPOTHETICAL PROTEIN ATU1540 A:4 -- 204
    5e-12  28%  1vz0A2 [d.268.1.1] CHROMOSOME PARTITIONING PROTEIN PARB A:23 -- 115
    1e-08  15%  1xw3A1 [d.268.1.4] SULFIREDOXIN A:28 -- 137
    1e-04  11%  1d6uA3 [d.17.2.1] COPPER AMINE OXIDASE A:186 -- 300
:510

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxPDESAQVHGISRVDVTHIHHYSRNPRRQQNPEYDRIKASIRAEGLDQPLVLSQEPGTSDYVLHSGGN
1vk1A           ------------VKKVEYVFIELDKMXPHEQLVQRLEDFIESVTGSGIFWKPMLLAKIPGTDEYLIVDGH
2hwjA1          ------------LSRIAIDKLRPTQIAVGFREVELKRKEWRETRDFLGNHIVPVVAGPKDRAYLI--DHH
1vz0A2          ------------VVRLPLASIRPNPRQPRKRFAEELKELADSIREKGLLQPLLVRPQGDG--YELVAGER
1xw3A1          ---PHMSIHIAAVHNVPLSVLI--RPLPSVLDPAKVQSLVDTIREDPDSVPPIWIKGAQGGDYFYSFGGC
1d6uA3          ---------------------------------NNSEEFAAAVKKRGITDAKKVITTPGYFDGKDGLKQD


                         .         .         *         .         .         .         .:140
query           TRLKILKDLFEETGDDRFRWVNCVIKPWSQESNLLFAHLRENELRGALPFIDKALAVFDAKALLEKELAV
1vk1A           HRWAGLQKLGAKR-------APSVILDYFDEG--VKVYTWYPAFXGDVNXVIERLKAEGLEVIEDEEIAF
2hwjA1          HLVLALSKEGVEH-------VLTSEVAKFSH-LGKDEFWSVXDHRNLIYPFDAQGL---RRQSGDIPKNI
1vz0A2          -RYRAALMAGLQE-------VPAVVKDLT-DREALELALVENLQR-------------------------
1xw3A1          HRYAAYQQLQRET-------IPAKLVQSTSDLRVYLGASTPD----------------------------
1d6uA3          ARLLKVISYLDVGDGNYWAHPIENLVAV------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETLSQRQLEELFRERGFGLSHSMISKMGYAVDTLWPVMPKALAAGLGRPQVEKIRALERAAREIWDRxxx
1vk1A           ALIGEKSFAIPGGLKVLDEMDQAXEIE-LVYYGLKEDAKADMEKGIDYVFIRXAPTKEEVMELVKRG---
2hwjA1          HDLEDD----------------------------------------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1d6uA3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vk1A           ----------------------------------------------------------------------
2hwjA1          ----------------------------------------------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1d6uA3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vk1A           ----------------------------------------------------------------------
2hwjA1          ----------------------------------------------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1d6uA3          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vk1A           ----------------------------------------------------------------------
2hwjA1          ----------------------------------------------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1d6uA3          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vk1A           ----------------------------------------------------------------------
2hwjA1          ----------------------------------------------------------------------
1vz0A2          ----------------------------------------------------------------------
1xw3A1          ----------------------------------------------------------------------
1d6uA3          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxx
1vk1A           --------------------
2hwjA1          --------------------
1vz0A2          --------------------
1xw3A1          --------------------
1d6uA3          --------------------