[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57445.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"

## Summary of PDB Search
:325
    5e-09  10%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    2e-08  14%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    2e-06  17%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    3e-05   9%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
:325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG1          ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxFGHADDGRDIGHDLRTRMWPSLAIAAPIFIGGLLVNTTFALLMVFFRG
2r6gG1          ----------------------ALGFSVITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRF
2onkC1          ----------------------------------------------------------------------
3dhwA1          ---------------------------------------VWETLAMTFVSGFFGFVIGLPVGVLLYVTRP
1tluA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TYLDLGGVVLCVALMSISTLFYVIMGQYLVGKLMHLVPVSGYVGGLDAFKFXXXXXXXXXXXXXXXXARW
2r6gG1          PGTLLKGMLIFQMFPAVLSLVALYALFDRLG-EYIPFIGLNTHGGVIFAYLGGIALH----------VWT
2onkC1          ----------------------------------------------------------------------
3dhwA1          GQIIANAKLYRTVSAIV---NIFRSIPFIILLVWMIPFTRVIVGTSIGL---QAAIVPLTVGAAPFIARM
1tluA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YRTLFLEEVGKDYVRTARAKGLSEFKVLFKHILKNALIPILTGAVVILPTLFLGSLILESFFGIPGLGSY
2r6gG1          IKG-YFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTL
2onkC1          ----GFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFGAVVVIYYPMIAPTL
3dhwA1          VEN-ALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITL-VGYSAMGGAVGAGGLG--
1tluA           -----VQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVISESHLTIHTWPEYGYAAIDL--FTCGE


                         .         *         .         .         .         .         +:350
query           TIDAIQAQDFAIVRAMVFLGSVLYILGLILTDISYTLVDPRVRxx
2r6gG1          AVGMQQYLNPQNYLWFAAAAVMSALPITIVFLLAQRWLVNGLT--
2onkC1          IYERYLSEGL-----------------------------------
3dhwA1          ---------------------------------------------
1tluA           DVDPWKAFEHLKKALKAKRVHVVEHERGRY---------------