[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57493.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qsaA2.bssp"
#ERROR : Can't open dsspfile "153lA.bssp"
#ERROR : Can't open dsspfile "2rh3A1.bssp"
#ERROR : Can't open dsspfile "1xsfA1.bssp"
#ERROR : Can't open dsspfile "2gicA1.bssp"

## Summary of PDB Search
:218
    5e-09  15%  1qsaA2 [d.2.1.6] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70)
    3e-07  11%  153lA  [d.2.1.5] GOOSE LYSOZYME
    1e-06   8%  2rh3A1 [a.43.1.10] PROTEIN VIRC2 A:82 -- 202
    6e-06  17%  1xsfA1 [d.2.1.8] PROBABLE RESUSCITATION-PROMOTING FACTOR RPFB A:23
    3e-04  27%  2gicA1 [a.260.1.1] NUCLEOCAPSID PROTEIN A:2 -- 422
:218

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEWYDYAKESEKKWGTPTPILM
1qsaA2          --------------------------------------------------YNDLFKRYTSGKEIPQSYAM
153lA           ------------------------------------------------DRYKTIIKKVGEKLCVEPAVIA
2rh3A1          ------------------------------------------------PIPHTAFEKSIIVQTSRMFPVS
1xsfA1          --------------------------------------------------------------VIDGSIWD
2gicA1          -------------------------------------------------EWLGWFEDQNRK---PTPDMM


                         .         .         *         .         .         .         .:140
query           AFIHRESSFRGDARPPRRWFLGFIPLPRSSSAYGYGQIQDPAWEDYLGANGGWFKSRADMEDVLDFIGWY
1qsaA2          AIARQESAWNPKVK-------------SPVGASGLMQIMPGTATHTVKMFSIGYSSPGQLLDPETNINIG
153lA           GIISRESHAGKVLKNGW---------GDRGNGFGLMQVDKRSHKPQ-----GTWNGEVHITQGTTILINF
2rh3A1          LIEAARNHFDPLGLET-------------ARAFGHKLATAALACFFAREKA-------------------
1xsfA1          AIAGCEAGGNWAINTG-------------NGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVT
2gicA1          QYAKRAVMSLQGLRE-------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NHISARRLGISKRNPEHLYLAYHEGHRGYQRGAWRRKPHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1qsaA2          TSYLQYVYQQFGNNRIFSSAAYNAGPGRVRTWLGNSAGRI------------------------------
153lA           IKTIQKKFPTKDQQLKGGISAYNAGAGNVRSYARMDIG--------------------------------
2rh3A1          ----------------------------------------------------------------------
1xsfA1          ----------------------------------------------------------------------
2gicA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxx
1qsaA2          --------
153lA           --------
2rh3A1          --------
1xsfA1          --------
2gicA1          --------