[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57498.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cvbA1.bssp"
#ERROR : Can't open dsspfile "1st9A.bssp"
#ERROR : Can't open dsspfile "1prxA.bssp"
#ERROR : Can't open dsspfile "2fy6A1.bssp"
#ERROR : Can't open dsspfile "2b5xA1.bssp"
#ERROR : Can't open dsspfile "1jfuA.bssp"
#ERROR : Can't open dsspfile "1xvwA1.bssp"
#ERROR : Can't open dsspfile "1lu4A.bssp"
#ERROR : Can't open dsspfile "1eejA1.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "1ewxA.bssp"
#ERROR : Can't open dsspfile "1xzoA1.bssp"
#ERROR : Can't open dsspfile "1x0rA1.bssp"
#ERROR : Can't open dsspfile "1wp0A1.bssp"
#ERROR : Can't open dsspfile "1kngA.bssp"
#ERROR : Can't open dsspfile "2cx3A1.bssp"
#ERROR : Can't open dsspfile "1gp1A.bssp"
#ERROR : Can't open dsspfile "2cv4A1.bssp"
#ERROR : Can't open dsspfile "2a4vA1.bssp"
#ERROR : Can't open dsspfile "1senA.bssp"
#ERROR : Can't open dsspfile "1uc7A.bssp"
#ERROR : Can't open dsspfile "1a8yA1.bssp"
#ERROR : Can't open dsspfile "2dlxA1.bssp"
#ERROR : Can't open dsspfile "1ovnA2.bssp"
#ERROR : Can't open dsspfile "2b5eA4.bssp"
#ERROR : Can't open dsspfile "1z5yE1.bssp"
#ERROR : Can't open dsspfile "1h4oA.bssp"
#ERROR : Can't open dsspfile "1xiyA1.bssp"
#ERROR : Can't open dsspfile "2b5eA3.bssp"
#ERROR : Can't open dsspfile "1wouA.bssp"
#ERROR : Can't open dsspfile "1v57A1.bssp"
#ERROR : Can't open dsspfile "1psqA.bssp"
#ERROR : Can't open dsspfile "1z6nA1.bssp"
#ERROR : Can't open dsspfile "1a8lA1.bssp"
#ERROR : Can't open dsspfile "1qgvA.bssp"
#ERROR : Can't open dsspfile "1egoA.bssp"
#ERROR : Can't open dsspfile "1fvqA.bssp"

## Summary of PDB Search
:193
    6e-40  45%  2cvbA1 [c.47.1.10] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    6e-22  26%  1st9A  [c.47.1.10] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    2e-20  18%  1prxA  [c.47.1.10] HORF6
    3e-20  13%  2fy6A1 [c.47.1.10] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    4e-20  18%  2b5xA1 [c.47.1.10] YKUV PROTEIN A:1 -- 143
    2e-19  20%  1jfuA  [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN TLPA
    1e-18  18%  1xvwA1 [c.47.1.10] HYPOTHETICAL PROTEIN RV2238C/MT2298 A:1 -- 153
    1e-18  17%  1lu4A  [c.47.1.10] SOLUBLE SECRETED ANTIGEN MPT53
    2e-18  10%  1eejA1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN A:61 -- 216
    5e-18  21%  1e2yA  [c.47.1.10] TRYPAREDOXIN PEROXIDASE
    2e-17  13%  1ewxA  [c.47.1.10] TRYPAREDOXIN I
    3e-17  15%  1xzoA1 [c.47.1.10] HYPOTHETICAL PROTEIN YPMQ A:3 -- 174
    4e-17  12%  1x0rA1 [c.47.1.10] PROBABLE PEROXIREDOXIN A:2 -- 242
    4e-17  13%  1wp0A1 [c.47.1.10] SCO1 PROTEIN HOMOLOG A:138 -- 297
    4e-16  16%  1kngA  [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN CYCY
    6e-16  19%  2cx3A1 [c.47.1.10] BACTERIOFERRITIN COMIGRATORY PROTEIN A:4 -- 163
    9e-14  12%  1gp1A  [c.47.1.10] GLUTATHIONE PEROXIDASE
    2e-13  16%  2cv4A1 [c.47.1.10] PEROXIREDOXIN A:24 -- 173
    3e-13  15%  2a4vA1 [c.47.1.10] PEROXIREDOXIN DOT5 A:59 -- 214
    3e-12  11%  1senA  [c.47.1.1] THIOREDOXIN-LIKE PROTEIN P19
    4e-12  10%  1uc7A  [c.47.1.1] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBD
    1e-09  10%  1a8yA1 [c.47.1.3] CALSEQUESTRIN A:3 -- 126
    2e-09  10%  2dlxA1 [c.47.1.24] UBX DOMAIN-CONTAINING PROTEIN 7 A:1 -- 147
    5e-09  19%  1ovnA2 [c.47.1.7] WINDBEUTEL A:24 -- 145
    1e-08   9%  2b5eA4 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:23 -- 141
    1e-06  21%  1z5yE1 [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE E:49 --
    2e-06  32%  1h4oA  [c.47.1.10] PEROXIREDOXIN 5
    4e-06  10%  1xiyA1 [c.47.1.10] PEROXIREDOXIN A:2 -- 180
    5e-06   9%  2b5eA3 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:240 -- 364
    5e-06  19%  1wouA  [c.47.1.16] THIOREDOXIN -RELATED PROTEIN, 14 KDA
    5e-06   9%  1v57A1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG A:62 --
    8e-06  22%  1psqA  [c.47.1.10] PROBABLE THIOL PEROXIDASE
    2e-05  14%  1z6nA1 [c.47.1.1] HYPOTHETICAL PROTEIN PA1234 A:1 -- 166
    5e-05   8%  1a8lA1 [c.47.1.2] PROTEIN DISULFIDE OXIDOREDUCTASE A:1 -- 119
    5e-05   9%  1qgvA  [c.47.1.8] SPLICEOSOMAL PROTEIN U5-15KD
    1e-04  19%  1egoA  [c.47.1.1] GLUTAREDOXIN
    6e-04  25%  1fvqA  [d.58.17.1] COPPER-TRANSPORTING ATPASE
:193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
2cvbA1          ----QYPELPLESPLIDAEL-PDPRGGRYRLSQFHEPL-LAVVFXCNHCPYVKGSIGELVALA-ERYRGK
1st9A           -----------GSDAPNFVL-EDTNGKRIELSDLKGKG-VFLNFWGTWCEPCKKEFPYMANQYKHFKSQG
1prxA           --------LLLGDVAPNFEA-NTTVGRIRFHDFLGDSWGILFSHPRDFTPVXTTELGRAAKLAPEFAKRN
2fy6A1          --------------HTLSTL-KTADNRPASVYLKKDKP-TLIKFWASWCPLCLSELGQTEKWAQDAKFSS
2b5xA1          --------MKLRQPMPELTGKAWLNGEVTREQLIGE-KPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQL
1jfuA           -EVAALTMASAPLKLPDLAFED-ADGKPKKLSDFRG-KTLLVNLWATWCVPCRKEMPALDELQGKLSGPN
1xvwA1          -------MLNVGATAPDFTL-RDQNQQLVTLRGYRGAKNVLLVFPLAFTGIXQGELDQLRDHLPEFENDD
1lu4A           -----------ADERLQFTATT-LSGAPFDGASLQG-KPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVT
1eejA1          ---------NVTNKMLLKQLNA-LEKEMIVYKAPQE-KHVITVFTDITCGYCHKLHEQMADYNALGITVR
1e2yA           --------AKLNHPAPEFDDXPNGTFKKVSLSSYKGKYVVLFFYPXDFTFVCPTEIIQFSDDAKRFAEIN
1ewxA           ----------LDKYLPGIEKLR-RGDGEVEVKSLAG-KLVFFYFSASWCPPCRGFTPQLIEFYDKFHESN
1xzoA1          ----QQIKDPLNYEVEPFTF-QNQDGKNVSLESLKGEVWLADFIFTNCETICPPMTAHMTDLQKKLKAEN
1x0rA1          -------IPLIGERFPEXEVTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLG
1wp0A1          ----------------PFSLTT-HTGERKTDKDYLGQWLLIYFGFTHCPDVCPEEIQVVDEIDSITTLPD
1kngA           -----------LPPLEGLQADN-VQVPGLDPAAFKG-KVSLVNVWASWCVPCHDEAPLLTELGKDKRFQL
2cx3A1          -------LVELGEKAPDFTL-PNQDFEPVNLYEVLKRGRPAVLFPAAFSPVCTKELCTFRDKXAQLEKAN
1gp1A           -------------TVYAFSARPLAGGEPFNLSSLRG-KVLLIENVASLXGTTVRDYTQMNDLQRRLGPRG
2cv4A1          ----------------------------IKLPDHYVSQGFVLFSHPADFTPVXTEFVSFARRYEDFQRLG
2a4vA1          ----DVNELEIGDPIPDLSL-LNEDNDSISLKKITENNRVVVFYPRASTPGSTRQASGFRDNYQELKEYA
1senA           ----------LGKGFGDH-IHWRTLEDGKKEAAASG-LPLMVIIHKSWCGACKALKPKFAESTEISELSH
1uc7A           -----------QTHLNFTQI-KTVDELNQALVEAKG-KPVMLDLYADWCVACKEFEKYTFSDPQVQKALA
1a8yA1          -----------GLDFPEYDGVDRVIVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAA
2dlxA1          -----------DLFRPPIDLMHKGSETAKECGQMQN-KWLMINIQNVQDFACQCLNRDVWSNEAVKNIIR
1ovnA2          ------------------------DELSFEKTVERF-PYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKD
2b5eA4          ----------EAVAPEDSAVVK-LATDSFNEYIQSH-DLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN
1z5yE1          -------------------------GQFYQADVLTQGKPVLLNVWATWCPTSRAEHQYLNQLSA----QG
1h4oA           --------IKVGDAIPAVEVFEGEPGNKVNLAEFKGKKGVLFGPGCTHLPFVEQ--------AEALKAKG
1xiyA1          -----------NDLIPNVKVMIDVDFTSIDTHELFNNKKILLISLPGAFTPTKMIPGYEEEYDYFIKENN
2b5eA3          ---------------------------EIDGSVFAQYGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLM
1wouA           ------------------RAVEQHNGKTI-FAYF---TGSKDAGGKSWCPDCVQAEPVVREGLKHISEGC
1v57A1          -------------PAGREMWQRMEQSHWLLDGKKDA-PVIVYVFADPFCPYCKQFWQQARPWVDSGKVQL
1psqA           --------LQVGDKALDFSLTT-TDLSKKSLADFDGKKKVLSVVDTGICSTTRRFNEELAGL------DN
1z6nA1          ------------------------------LQRIER-RYRLLVAGEMWCPDCQINLAALDFAQRLQ--PN
1a8lA1          ---------------GLISDDKKVIKEEFFSKMVNP-VKLIVFVRKDHCQYCDQLKQLVQELSELTDKL-
1qgvA           ------------------------------ILSEED-RVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNF-
1egoA           ----------------------------------------TVIFGRSGCPYCVRAKDLAEKLSNERDDFQ
1fvqA           ---------------------------------------------CSAC--TNTINTQLRAL------KG


                         .         .         *         .         .         .         .:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQF
2cvbA1          VAFVGINANDYEKYPEDAPEKXAAFAEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRV
1st9A           VEIVAVN-------VGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVV-----
1prxA           VKLIALSIDSVEDAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAEK--DEKGMPVTARVVF
2fy6A1          ANLITVASPGF-LHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRI--V
2b5xA1          NVVA---VHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHF---
1jfuA           FEVVAINIDT-----RDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKALGMPTSVLVDPQGCEIATIA-
1xvwA1          SAALAISVGPPPTHKI------WATQSGFTFPLLSDFWPHGAVSQAYGVFNEQATFVVDRSGIIRFAEMK
1lu4A           FVGIAT---------RADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNP
1eejA1          YLAFPRQGLDSDKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGY----
1e2yA           TEVISCSCDSEYSHLQW-TSVDRKKGGLGPXAIPXLADKTKAIARAYGVLDYRGVFIIDPNGKLRQIIIN
1ewxA           FEVVFC------TWDEEEDGFAGYFAKMPWLAVPFAQEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRA
1xzoA1          IDVRISFSVDPENDKPKQLKKFAANYPLSFDNWDFLTGYSQSEIEEFALKSQSSFYLVGPDGKVLKDYNG
1x0rA1          VDLIGLSV----DSVFSHIKWKEWIERHIGIPFPIIADPQGTVARRLGLLHAESVFIVDARGVIRTXLYY
1wp0A1          LTPLFISIDPERDTKEAIANYV-KEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIDHTIIXY
1kngA           VGI---------NYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYK---
2cx3A1          AEVLAIS--------VDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKFIVKPDGTVAYKWVT
1gp1A           LVVLGFPC--------NQFGHQENAKNEEILNCLKYVRPGGGFEPNFMLFEKCEVNGEKAHPLFAFPTPS
2cv4A1          VDLIGLSVDSVFSHIK--WKEWIERHIGVRIPFPIIADPQGTVARRLATHTVRGVFIVDARGVIRTXLYY
2a4vA1          A-VFGLSA--------DSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGASGSIRSHFIFVDGKLKFKR--
1senA           NFVMVNLEDEEEP------KDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSY--------------
1uc7A           DTVLLQANVT---ANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARV---------------------
1a8yA1          QVLEDK----------------------GVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDG--
2dlxA1          EHFIFWQVYHD-------------------------SEEGQRYIQFYKLGDFPYVSILDPRTGQKLV---
1ovnA2          LLIATVGVKDYG------------------------ELENKALGDRYDDKNFPSIFLFKGNADEYVQLP-
2b5eA4          --------ITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSID-----------------------
1z5yE1          IRVVGMNY-------KDDRQKAISWLKELGNPYALLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYR---
1h4oA           VQVVALSVND--------AFVTGEWGRAHKAEVRLLADPTGAFGKET-----------------------
1xiyA1          FDIYCITNNDIY-----VLKSWFKSMDIKKIKY--ISDGNSSFTDSM-----------------------
2b5eA3          NFVSIDA--------RKFGRHAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESK---
1wouA           VFIYCQ-----------------------VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECL
1v57A1          RTLLVGVIKPESPATAAAILASLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTL------
1psqA           TVVLTVS--------XDLPFAQKRWCGAEGLDNAIXLYFDHSFGRDY-----------------------
1z6nA1          IELAIISK-------GRAEDDLRQRLALERIAIPLVLVLDEEFNLLGRFVERPQAVLDGGPQALAAY---
1a8lA1          -------SYEIVDFDTPEGKELAKRYRIDRAPATTITQDGKDFGVRYFGLPAGHEF--------------
1qgvA           --------AVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGINWAMEDKQEMVDIETVYRGAR
1egoA           YQYVDIRAE------GITKEDLQQKAGKPVETVPQIFVDQQHI---------------------------
1fvqA           VTKCDISLVTVTYDNEVTADSIKEIIEDCGF---------------------------------------


                         +         .         .         .         .         *         .:210
query           DDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCNIKWKPGNEPDxxx
2cvbA1          NDN-PKDPSKVQSHDLEAAIEALLRGEEPPLKEAPAIGCTIKWRPGNEPE---
1st9A           -----------------------------------------------------
1prxA           VFGPDKKLKPATTGRNFDEILRVV--ISLQLTAEKRVATPVDWKDGDS-----
2fy6A1          KGSINEAQA---LALIRDPNADL------------------------------
2b5xA1          -----------------------------------------------------
1jfuA           ------GPAEWASEDALKLIRAAT-----------------------------
1xvwA1          QPGEVRDQ-----RLWTDALAALTA----------------------------
1lu4A           -------TAAMSQDELSGRVAAL------------------------------
1eejA1          ---QPPKEMK---EFLDEHQKMT------------------------------
1e2yA           DXPIGRNV-----EEVIRLVEALQFVE--------------------------
1ewxA           RA--------TLVKDPEGEQFPWK-----------------------------
1xzoA1          VENT-------PYDDIISDVKSASTLK--------------------------
1x0rA1          PXE--------LGRLVDEILRIVKALKL---GDSLKRAVPADWPNNEII----
1wp0A1          LIGPDGEFLNKRKGEIAASIATH------------------------------
1kngA           -----------------------------------------------------
2cx3A1          DNPLNEPDY----DEVVREANKIAGEL--------------------------
1gp1A           DDATALMTDPKFITWSPVFEKFLVGPDGVPVRRYSRRFLTIDIEPD-------
2cv4A1          PXELGRLV-----DEILRIVKA-------------------------------
2a4vA1          ---VKISPEVSVNDAKKEVLEVAEKFK--------------------------
1senA           -----------------------------------------------------
1uc7A           -----------------------------------------------------
1a8yA1          ---------EFSADTLVEFLLDVLE----------------------------
2dlxA1          -----------------------------------------------------
1ovnA2          ------SHVDVTLDNLKAFVSANT-----------------------------
2b5eA4          -----------------------------------------------------
1z5yE1          -----------------------------------------------------
1h4oA           -----------------------------------------------------
1xiyA1          -----------------------------------------------------
2b5eA3          -----------------------------------------------------
1wouA           Q----------------------------------------------------
1v57A1          -----------------------------------------------------
1psqA           -----------------------------------------------------
1z6nA1          -----------------------------------------------------
1a8lA1          -----------------------------------------------------
1qgvA           KGRGLVVSP--------------------------------------------
1egoA           -----------------------------------------------------
1fvqA           -----------------------------------------------------