[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57806.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1prxA.bssp"
#ERROR : Can't open dsspfile "1x0rA1.bssp"
#ERROR : Can't open dsspfile "2cv4A1.bssp"
#ERROR : Can't open dsspfile "1xiyA1.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "2cx3A1.bssp"
#ERROR : Can't open dsspfile "1xvwA1.bssp"
#ERROR : Can't open dsspfile "1h4oA.bssp"
#ERROR : Can't open dsspfile "1xzoA1.bssp"
#ERROR : Can't open dsspfile "1psqA.bssp"
#ERROR : Can't open dsspfile "2cvbA1.bssp"
#ERROR : Can't open dsspfile "1wp0A1.bssp"
#ERROR : Can't open dsspfile "2b5xA1.bssp"
#ERROR : Can't open dsspfile "1jfuA.bssp"
#ERROR : Can't open dsspfile "1st9A.bssp"
#ERROR : Can't open dsspfile "1gp1A.bssp"
#ERROR : Can't open dsspfile "2a4vA1.bssp"
#ERROR : Can't open dsspfile "2fy6A1.bssp"
#ERROR : Can't open dsspfile "1kngA.bssp"
#ERROR : Can't open dsspfile "1ewxA.bssp"
#ERROR : Can't open dsspfile "1eejA1.bssp"
#ERROR : Can't open dsspfile "1lu4A.bssp"
#ERROR : Can't open dsspfile "1fguA2.bssp"
#ERROR : Can't open dsspfile "1uc7A.bssp"
#ERROR : Can't open dsspfile "1senA.bssp"
#ERROR : Can't open dsspfile "1ovnA2.bssp"
#ERROR : Can't open dsspfile "2b5eA4.bssp"

## Summary of PDB Search
:212
    3e-38  51%  1prxA  [c.47.1.10] HORF6
    2e-32  34%  1x0rA1 [c.47.1.10] PROBABLE PEROXIREDOXIN A:2 -- 242
    4e-31  40%  2cv4A1 [c.47.1.10] PEROXIREDOXIN A:24 -- 173
    3e-27  15%  1xiyA1 [c.47.1.10] PEROXIREDOXIN A:2 -- 180
    5e-27  28%  1e2yA  [c.47.1.10] TRYPAREDOXIN PEROXIDASE
    3e-23  28%  2cx3A1 [c.47.1.10] BACTERIOFERRITIN COMIGRATORY PROTEIN A:4 -- 163
    6e-23  22%  1xvwA1 [c.47.1.10] HYPOTHETICAL PROTEIN RV2238C/MT2298 A:1 -- 153
    6e-23  20%  1h4oA  [c.47.1.10] PEROXIREDOXIN 5
    6e-22  14%  1xzoA1 [c.47.1.10] HYPOTHETICAL PROTEIN YPMQ A:3 -- 174
    2e-21  21%  1psqA  [c.47.1.10] PROBABLE THIOL PEROXIDASE
    2e-21  13%  2cvbA1 [c.47.1.10] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    1e-19  16%  1wp0A1 [c.47.1.10] SCO1 PROTEIN HOMOLOG A:138 -- 297
    1e-19  12%  2b5xA1 [c.47.1.10] YKUV PROTEIN A:1 -- 143
    3e-18  19%  1jfuA  [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN TLPA
    8e-16  26%  1st9A  [c.47.1.10] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    2e-15   7%  1gp1A  [c.47.1.10] GLUTATHIONE PEROXIDASE
    2e-15  22%  2a4vA1 [c.47.1.10] PEROXIREDOXIN DOT5 A:59 -- 214
    1e-14  15%  2fy6A1 [c.47.1.10] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    5e-14   9%  1kngA  [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN CYCY
    3e-13  10%  1ewxA  [c.47.1.10] TRYPAREDOXIN I
    4e-13   7%  1eejA1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN A:61 -- 216
    5e-12  20%  1lu4A  [c.47.1.10] SOLUBLE SECRETED ANTIGEN MPT53
    2e-11  12%  1fguA2 [b.40.4.3] REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT
    4e-10   6%  1uc7A  [c.47.1.1] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBD
    1e-05  11%  1senA  [c.47.1.1] THIOREDOXIN-LIKE PROTEIN P19
    4e-05   9%  1ovnA2 [c.47.1.7] WINDBEUTEL A:24 -- 145
    2e-04  11%  2b5eA4 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:23 -- 141
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
1prxA           --LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVXTTELGRAAKLAPEFAKRNVKLIALS
1x0rA1          ----IGERFPEXEVTTDHGVIKLPDVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS
2cv4A1          --------------------LPDHYVSQGKWFVLFSHPADFTPVXTTEFVSFARRYEDFQRLGVDLIGLS
1xiyA1          ----ENDLIPNVKNNNDFTSIDTHELFNNKKILLISLPGAFTPTXSTKIPGYEEEYDYFIKEFDDIYCIT
1e2yA           -AAKLNHPAPEFDPNGTFKKVSLSSYKGK-YVVLFFYPXDFTFVCPTEIIQFSDDAKRFAEINTEVISCS
2cx3A1          ----LGEKAPDFTLPNQDFPVNLYEVLKRGPAVLIFFPAAFSPVCTKELCTFRDKXAQLEKANAEVLAIS
1xvwA1          ----VGATAPDFTLRDQNQLVTLRGYRGAKNVLLVFFPLAFTGIXQGELDQLRDHLPEFENDDSAALAIS
1h4oA           --IKVGDAIPAVEEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSTHLPGFVEQAEALKAKGVQVACLS
1xzoA1          IKDPLNYEVEPFTFQNQDGNVSLESLKGE-VWLADFIFTNCETICPPMTAHMTDLQKKLKAEDVRIISFS
1psqA           --LQVGDKALDFSDLSKKSLADF----DGKKKVLSVVPSIDTGICSTQTRRFNEELAGLD--NTVVLTVS
2cvbA1          -ELPLESPLIDAELPDPRGRYRLSQFHEP--LLAVVFXCNHCPYVKGSIGELVALA-ERYRGKVAFVGIN
1wp0A1          ----------PFSLTTHTGRKTDKDYLGQ-WLLIYFGFTHCPDVCPEELEKXIQVDSITTLPDLTPLFIS
2b5xA1          --MKLRQPMPELTGEKAWLNGEVTRELIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQ-LNVVAVH
1jfuA           --ASAPLKLPDLAFEDADGPKKLSDFRGKTLLVNL--WATWCVPCRKEMPALDELQGKLSGPNFEVVAIN
1st9A           -----GSDAPNFVLEDTNGRIELSDL--KGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVN
1gp1A           --------VYAFSARPLAGGEPFNLSSLRGKVLLIENVASLXGTTVRDYTQMNDLQRRLGPRGLVVLGFP
2a4vA1          ----IGDPIPDLSLLNEDNSISLKKITENNVVVFFVYPRASTPGSTRQASGFRDNYQELKEYAA-VFGLS
2fy6A1          --------HTLSTLKTADNPASVYLKKDK--PTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVA
1kngA           ----ALPPLEGLQADNVQVPGLDPAAFKGKVSLVNVWASWCVP-CHDEAPLLTELGKDKRF---QLVGIN
1ewxA           ----LDKYLPGIEKLRRGDEVEVKSLAGKLVFFYFSAS--WCPPCRGFTPQLIEFYDKFESKNFEVVFCT
1eejA1          ----VTNKMLLKQLNALEKE-MIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQ
1lu4A           -----ADERLQFTATTLSGPFDGASLQGKPAVLWFWTP--WCPFCNAEAPSLSQVAAANPAVTFVGIATR
1fguA2          ----------------------------------------------------------------------
1uc7A           ---QTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVA-CKEFEKYTFSDPQVQKALADTVLLQA
1senA           ----LGKGFGDHIHWRTLEDGKKEAAASGLPLMVI-IHKSWCGACKALKPKFAESTEISELSHNFVMVNL
1ovnA2          ----------------------FEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIA---
2b5eA4          ----EAVAPEDSAVV-KLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITL----


                         .         .         *         .         .         .         .:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYP
1prxA           IDSVEDHLAWSKDINAYNSEKLPFPIIDDRNRELAILLGMLDPEKGMPVTARVVFVFGPDKKLKLSILYP
1x0rA1          VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAE-SATHTVRGVFIVDARGVIRTXLYYP
2cv4A1          VDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAE-SATHTVRGVFIVDARGVIRTXLYYP
1xiyA1          NNDIYVLKSWFKSMDIK-----KIKYISDGNSSFTDSMNMLVNFFMGMRPWRFVAIVENNILVKMFQ-EK
1e2yA           CDSEYSHLQWTVDRKKGGLGPXAIPXLADKTKAIARAYGVLDE--DSGVAYRGVFIIDPNGKLRQIIIND
2cx3A1          VDSPWCLKKFKDENR------LAFNLLSDYNREVIKLYNVYHEKGLKXVAKRAVFIVKPDGTVAYKWVTD
1xvwA1          VGPPPTHKIW----ATQSGFTFPLLSDFWPHGAVSQAYGVFNEQ--AGIANRGTFVVDRSGIIRFAEMKQ
1h4oA           VNDAFVTGEW----GRAHKAEGKVRLLADPTGAFGKETDLLLDSIFGNRRLKRFSMVVQDGIVKALNVEP
1xzoA1          VDPENDKPKQLKKFAANYPLFDNWDFLTGYSQSEIEEFALKSEGEDQVIHQSSFYLVGPDGKVLKD--YN
1psqA           XDLPFAQKRWC----GAEGLDNAIXLSDYFDHSFGRDYALLINEWH--LLARAVFVLDTDNTIRYVYVDN
2cvbA1          ANDYEKYPEDAPEAAFAEEHGIFFPYLLDETQEVAKAYRALR--------TPEVFLFDERRLLRYHGRVN
1wp0A1          IDPERDTKEAIANYVKEFSPKVGLTGTREEVDQVARAYRVYYDEDYIVDHTIIXYLIGPDGEFLDYFGQN
2b5xA1          MPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEY--------VPAYYVFDKTGQLRHFQA--
1jfuA           IDTRDPEKPKTFLKEANLTR---LGYFNDQKAKVFQDLKAIGR----ALGMPTSVLVDPQGCEIATIAGP
1st9A           VGESIAVHNFMKSYGV------NFPVVLDTDRQVLDAYDVS--------PLPTTFLINPEGKVVKVVT-G
1gp1A           CNQFGHQENAKNE------EILNCLKYVRPGGGFEPNFMLFEKCEFLREVLPTPSDDATALMTDPKFITW
2a4vA1          ADSVTSQKKFQ------SKQNLPYHLLSDPKREFIGLLGAKKT---PLSGSIRSHFIFVDGKLKFKISPE
2fy6A1          SPGFLHEKKDGDFQKWAGLNYPKLPVVTDNGGTIAQSLNISV--------YPSWALIGKDGDVQRIVKGS
1kngA           YKDAADNARR----FLGRYGNPFGRVGVDANGRASIEWGVYG--------VPETFVVGREGTIVYKLVGP
1ewxA           WDEEEDGFAG---YFAKMPWLAVPFAQSEAVQKLSKHFNVES--------IPTLIGVDADSGDVVTTRAR
1eejA1          GLDSDAEKEMKAIWCAKDAFDDVMAGKSVAPASCDVDIADHYALGVQVSGTPAVVLSNGTLVPGY-----
1lu4A           -ADVGAMQSFVSKYNL------NFTNLNDADGVIWARYNVPW--------QPAFVFYRADGTSTFVNNPT
1fguA2          ------------GIDDLENKSKDSLVIIGICKSYEDATKITVRSNNREVAKRNIYLMDTGKVVTATLWGE
1uc7A           NVTANDAQDV-ALLKHLNVLGLPTILFFDGQGQEHPQARVTGF---------------------------
1senA           EDEEEPKDED----FSPDGGYIPRILFLDPSGKVHPEI--------------------------------
1ovnA2          -------------------TVGVKDYGELENKALGDRYKVDDKN------FPSIFLFKGNADEYVQLPSH
2b5eA4          --AQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSID--------------------------------


                         +         .         .         .         .         *         .:210
query           PSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQP
1prxA           ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEA-KKLFPKGVFTKKKYLRYTPQP
1x0rA1          XELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEEGLIVPPPTTEDQARARXESGYRSLDWWFCWDTPA
2cv4A1          XELGRLVDEILRIVKALKLGDSLKRAVP------------------------------------------
1xiyA1          DKQHNIQTDPYDIST-------------------------------------------------------
1e2yA           XPIGRNVEEVIRLVEALQFVEEH-----------------------------------------------
2cx3A1          NPLNEDYDEVVREANKIA----------------------------------------------------
1xvwA1          PGEVRDQRLWTDALAALT----------------------------------------------------
1h4oA           DGTGLTCSLAPNIISQL-----------------------------------------------------
1xzoA1          GVENTPYDDIISDVKSAS----------------------------------------------------
1psqA           INSEPNFEAAIAAAKAL-----------------------------------------------------
2cvbA1          DNPKDPSHDLEAAIEALLRGEAPAIGCTIKWRPGNE----------------------------------
1wp0A1          KRKGEIAASIATHXR-------------------------------------------------------
2b5xA1          --GGSGMKMLEKRVNRV-----------------------------------------------------
1jfuA           --AEWASEDALKLIRAAT----------------------------------------------------
1st9A           TMTESMIHDYMNLI--------------------------------------------------------
1gp1A           SPVCRNDVSWNFEKFLVGVRRYSRRFLTIDIEPDIETLL-------------------------------
2a4vA1          VSVNDAKKEVLEVAEKFK----------------------------------------------------
2fy6A1          ----INEAQALALIRDPN----------------------------------------------------
1kngA           ITPDNLRSVLLPQMEKA-----------------------------------------------------
1ewxA           ATLVKDPEGEQF----------------------------------------------------------
1eejA1          ----QPPKEMKEFLDEH-----------------------------------------------------
1lu4A           AAMSQD--ELSGRVAAL-----------------------------------------------------
1fguA2          DDKFDGSRQPVLAIKGARVSDFGGRSLSVLS--SSTIIANPDIPEAYKLRGWFDAEGQALD---------
1uc7A           ----------------------------------------------------------------------
1senA           ----------------------------------------------------------------------
1ovnA2          --VDVTLDNLKAFVSAN-----------------------------------------------------
2b5eA4          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NK
1prxA           --
1x0rA1          SR
2cv4A1          --
1xiyA1          --
1e2yA           --
2cx3A1          --
1xvwA1          --
1h4oA           --
1xzoA1          --
1psqA           --
2cvbA1          --
1wp0A1          --
2b5xA1          --
1jfuA           --
1st9A           --
1gp1A           --
2a4vA1          --
2fy6A1          --
1kngA           --
1ewxA           --
1eejA1          --
1lu4A           --
1fguA2          --
1uc7A           --
1senA           --
1ovnA2          --
2b5eA4          --