[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57898.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mjhA.bssp"
#ERROR : Can't open dsspfile "1wjgA.bssp"
#ERROR : Can't open dsspfile "1jmvA.bssp"
#ERROR : Can't open dsspfile "2gm3A1.bssp"
#ERROR : Can't open dsspfile "1tq8A.bssp"

## Summary of PDB Search
:152
    4e-20  25%  1mjhA  [c.26.2.4] PROTEIN (ATP-BINDING DOMAIN OF PROTEIN MJ0577)
    8e-17  26%  1wjgA  [c.26.2.4] PROBABLE ATP BINDING PROTEIN
    7e-14  14%  1jmvA  [c.26.2.4] UNIVERSAL STRESS PROTEIN A
    7e-12  28%  2gm3A1 [c.26.2.4] UNKNOWN PROTEIN A:5 -- 175
    5e-11  33%  1tq8A  [c.26.2.4] HYPOTHETICAL PROTEIN RV1636
:152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxIIVTVDGSENXXXXXXXXXXXXXXXXNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQL
1mjhA           -----------ILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDERE------IKVEEFENELKNKL
1wjgA           -----------ILLAYDGSEHARRAAEVAKAEAEAHGARLIVVHAYEPVPDYLGE------PFFEEALRR
1jmvA           -----------ILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLID---VNMSSMQDR
2gm3A1          -------------------------------------------------------------EDFRDXRQS
1tq8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVIGRRGLSRFEALLLGSVSEKV
1mjhA           TEE-AKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENV
1wjgA           RLERAEGVLEEARALTGVPKED--ALLLEGVPAEAILQAARAEKADLIVMGTRGLGALGSLFLGSQSQRV
1jmvA           ISTETQKALLDLAESVDYPISEK--LSGSGDLGQVLSDAIEQYDVDLLVTGHHQDFW---SKLMSSTRQV
2gm3A1          NKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRG--------LGTVSAFC
1tq8A           ----------------------------VGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANV


                         +         .         .         .         .         *         .:210
query           VRHASGPVTIIH
1mjhA           IKKSNKPVLVV-
1wjgA           VAEAPCPVLLV-
1jmvA           MNTIKIDMLVVP
2gm3A1          VKHAECPVXTI-
1tq8A           SRRAKVDVLIVH