[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57974.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j3wA.bssp"
#ERROR : Can't open dsspfile "1skoB.bssp"

## Summary of PDB Search
:120
    9e-15  23%  1j3wA  [d.110.7.1] GIDING PROTEIN-MGLB
    7e-11  18%  1skoB  [d.110.7.1] LATE ENDOSOMAL/LYSOSOMAL MP1 INTERACTING PROTEIN
:120

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLTAVLNDLNSTSADIEASGVISTDGLMIAAVLPTTLDEDRVGAMSAAMLSLGDRSAKELERGALE
1j3wA           -----------------TGARYALLIDRKGFVLAHKEPKPPPLDTLATLVAGNAAATQALAKLLGEARFQ
1skoB           -----LTQVLSQANTGG--VQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNDSLK


                         .         .         *         .         .         .         .:140
query           QVLIKGDHGYVLMTYAGDEAVLTVMAKPRAKLGLIFLDVKRAAESIAxxx
1j3wA           EEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRASEALA---
1skoB           FILMDCMEGRVAITRVAN-LLLCMYAKETVGFGMLKAKAQALVQYLE---