[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA57987.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wj0A.bssp"
#ERROR : Can't open dsspfile "1ul4A.bssp"
#ERROR : Can't open dsspfile "2conA1.bssp"

## Summary of PDB Search
:397
    4e-15  19%  1wj0A  [g.72.1.1] SQUAMOSA PROMOTER-BINDING PROTEIN-LIKE 12
    6e-14  13%  1ul4A  [g.72.1.1] SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 4
    2e-05  13%  2conA1 [g.41.15.1] NIN ONE BINDING PROTEIN A:8 -- 73
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------
2conA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxLAYKAKEQGKHLVKIDPWFASSKTCHVCQHKMDAMPLNIRSWACPTCHTRHDR
1wj0A           ------------------CCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVL
1ul4A           -----------------RLCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDL
2conA1          -------------------------------VREARSYILRCHGCFKTTSDMNR----VFCGHCGNKTLK


                         .         .         .         .         *         .         .:420
query           DINAALNIQHQGILKLKAExxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           E----------------------------------------------
1ul4A           QE---------------------------------------------
2conA1          KVSVTINDDGTLHMHFSRN----------------------------