[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58119.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s80A.bssp"
#ERROR : Can't open dsspfile "1kqaA.bssp"
#ERROR : Can't open dsspfile "2npoA1.bssp"
#ERROR : Can't open dsspfile "1xatA.bssp"
#ERROR : Can't open dsspfile "1g95A1.bssp"
#ERROR : Can't open dsspfile "1i19A1.bssp"
#ERROR : Can't open dsspfile "1khrA.bssp"
#ERROR : Can't open dsspfile "1fwyA1.bssp"
#ERROR : Can't open dsspfile "1v3wA.bssp"
#ERROR : Can't open dsspfile "1yp2A1.bssp"
#ERROR : Can't open dsspfile "1j2zA.bssp"
#ERROR : Can't open dsspfile "1xhdA.bssp"
#ERROR : Can't open dsspfile "1kgqA.bssp"
#ERROR : Can't open dsspfile "1z90A1.bssp"
#ERROR : Can't open dsspfile "1qq0A.bssp"

## Summary of PDB Search
:258
    5e-42  38%  1s80A  [b.81.1.6] SERINE ACETYLTRANSFERASE
    2e-21  19%  1kqaA  [b.81.1.3] GALACTOSIDE O-ACETYLTRANSFERASE
    1e-19  18%  2npoA1 [b.81.1.8] ACETYLTRANSFERASE A:3 -- 197
    5e-17  12%  1xatA  [b.81.1.3] XENOBIOTIC ACETYLTRANSFERASE
    4e-15  12%  1g95A1 [b.81.1.4] N-ACETYLGLUCOSAMINE-1-PHOSPHATE A:252 -- 452
    1e-14  11%  1i19A1 [d.58.32.3] CHOLESTEROL OXIDASE A:274 -- 613
    5e-12  23%  1khrA  [b.81.1.3] STREPTOGRAMIN A ACETYLTRANSFERASE
    2e-11  17%  1fwyA1 [b.81.1.4] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE A:252
    3e-11  13%  1v3wA  [b.81.1.5] FERRIPYOCHELIN BINDING PROTEIN
    4e-11  10%  1yp2A1 [b.81.1.4] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    2e-10  14%  1j2zA  [b.81.1.1] ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-
    5e-10  18%  1xhdA  [b.81.1.5] PUTATIVE ACETYLTRANSFERASE/ACYLTRANSFERASE
    2e-09  24%  1kgqA  [b.81.1.2] 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-
    7e-08  18%  1z90A1 [b.81.1.4] AT3G03250 PROTEIN A:384 -- 469
    6e-05  10%  1qq0A  [b.81.1.5] CARBONIC ANHYDRASE
:258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKRLQEEIKCVFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHP
1s80A           IIDCAACDIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHP
1kqaA           -----------MTERIRAGKLFTDGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENFSYGS
2npoA1          VAKNMGYKE-CIFLDDFKGMKFESTLPKYDFFIAIIRKKIYQKISENGFKIVNL-------------IHK
1xatA           -------------------------------------------------------DDCARYLMPDRDDVD
1g95A1          --------LKGQTKIGAETVLTNGTYVVDSTIGAGAVITNSMIEESSVADGVIVGPYAHIRPNSSLGAQV
1i19A1          -----------LFAPKGADGRTFEKFVAESGGAEAIWYPFTEKPWMKVWTVSPSLSGPYNYIFSDNLPEP
1khrA           -----------------------------------------------------------------LEKLE
1fwyA1          ----------------------------------------------------------------------
1v3wA           -------------------------------------------------------VDENAVVIGDVVLEE
1yp2A1          --------------------------------------VIGEGCVIKNCKIHHSVVGLRSCISEGAIIED
1j2zA           VTLQGHTFVGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNLIREFCMINPGTEGGIKKTLIGDKNLL
1xhdA           ---------------------------------------------------------------SSAFIAD
1kgqA           ------------------------------------------RFQKEGFRVVPPATVRQGAFIARNTVLM
1z90A1          ----------------------------------------------------------------SIELGP
1qq0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTXXXXXXXXXXXXXXXPIHIGS
1s80A           AAKIGHGIXFDHATGIVVGETSVIENDVSILQGVTLGGTGKESGDRHPKVREGVXIGAGAKILGNIEVGK
1kqaA           NIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPMYSFPITIGNNVWIGSHVVINPGVTIGD
2npoA1          SALISPSAIVEENAGILIMPYVVINAKAKIEKGVILNTSSGAKCAGNVKIGKNCFLGINSCVLPNLSLAD
1xatA           KLVIGSFCSIGSGAFIMAGNQGHRAEWASTFPFHFMHEEPGYQPAGDTLIGHEVWIGTEAMFMPGVRVGH
1g95A1          HIGNFVEVKGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTITVNKYKTVIGNNVFVGSNSTIIAPVELGD
1i19A1          ITDMIGAINAGNP-GIAPLFGPAMYEITKLGLAATNANDIWGWSKDV--------QFYIKATTLRLTEGG
1khrA           NVEVGEYSYYDSKHYPILNDKLKIGKFCSIGPGVTLFGNGWEKHKGDTIIGNDVWIGKDVVIMPGVKIGD
1fwyA1          --------MLRDPARFDLRGTLTHGRDVEIDTNVIIEG---------NVTLGHRVKIGTGCVIKNSVIGD
1v3wA           KTSVWPSAVLRGDIEIYVGKYSNVQDNVSIHTSHGYPTEIGEYMVHGAKVGNYVIIGISSVILDGAKIGD
1yp2A1          SLLMGADYYE--TDADRKLLAAKGSVPIGIGKNCHIKRAII---DKNARIGDNVKIINKDNVQEAARETD
1j2zA           MAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQ--------------------FVRIAK
1xhdA           YVTITGDVYV--GEESSIWFNTVIRGDVSIGDRVNVQQCTLHQSPQYPLILEDDVTVGHQVILHSCHIKK
1kgqA           PSYVNIGAYVDEGTWATVGSCAQIGKNVHLSGGVGIGGV-LEPLQANPTI-----------------IED
1z90A1          EFKKVATFLSRFKSSIVELDSLKVSGDVWFGSSIVLKGKVTVAA----------------------KSGV
1qq0A           ----GKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVG----NNCVLEPRSAAIGVTIPD


                         +         .         .         .         .         *         .:210
query           GVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRREAKHQAMAKRIGFDAYGTPQDTPDPIERAIHGLIE
1s80A           YAKIGANSVVLNPVPEYATAAGVPARIV------------------------------------------
1kqaA           NSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHY--------------------------------
2npoA1          DSILGGGATLVKNQDEKGVFVGVPAKRME-----------------------------------------
1xatA           GAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYQ
1g95A1          NSLVGAGSTITKDVPADAIAIGRGRQINKDEYATR-----------------------------------
1i19A1          GAVVTSRANIATVINDFTEWFHERIEFYRAKGEFPLNGP-------------------------------
1khrA           GAIVAANSVVVKDIAPYMLAGGNPANEIKQRDQDTINQLLDIK---------------------------
1fwyA1          DCEISPYTVVEDANLAAACTIG------------------------------------------------
1v3wA           HVIIGAGAVVPPNIPDYSLVLGVPGKVVRQ----------------------------------------
1yp2A1          GYFIKSGIVTVIKIPSGIII--------------------------------------------------
1j2zA           GCMIAGKSALGKDVPPYCTVEGNRAFIRGLNRHRMR------------------QLLESKDIDFIYALYK
1xhdA           DALIGXGSIILKKIPPNTLAFGRPAKVI------------------------------------------
1kgqA           NCFIGARSEVVEGV--------------------------------------------------------
1z90A1          KLEIPDRAVVENKN--------------------------------------------------------
1qq0A           GRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAE--------------------------


                         .         .         .         +         .         .         .:280
query           HIQRLDERIEQMTAEIKNLGGDLPxxxxxxxxxxxxxxxxxxxxxxxx
1s80A           ------------------------------------------------
1kqaA           ------------------------------------------------
2npoA1          ------------------------------------------------
1xatA           HWKQRQ------------------------------------------
1g95A1          ------------------------------------------------
1i19A1          ------------------------------------------------
1khrA           ------------------------------------------------
1fwyA1          ------------------------------------------------
1v3wA           ------------------------------------------------
1yp2A1          ------------------------------------------------
1j2zA           RLFRPIPSLRESAKLELEEHANNP------------------------
1xhdA           ------------------------------------------------
1kgqA           ------------------------------------------------
1z90A1          ------------------------------------------------
1qq0A           ------------------------------------------------