[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58132.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1uf9A.bssp"
#ERROR : Can't open dsspfile "1knqA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"

## Summary of PDB Search
:206
    1e-45  21%  1e2dA  [c.37.1.1] THYMIDYLATE KINASE
    3e-41  19%  1g3uA  [c.37.1.1] THYMIDYLATE KINASE
    4e-39  43%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    3e-19  13%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    4e-18  19%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    1e-16  18%  1uf9A  [c.37.1.1] TT1252 PROTEIN
    4e-11  10%  1knqA  [c.37.1.17] GLUCONATE KINASE
    2e-10  15%  1e2hA  [c.37.1.1] THYMIDINE KINASE
:206

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTELLLMFAARVE
1e2dA           -LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQK--KSDVEDHSVHLLFSANRW
1g3uA           -IEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRGQSVAADIAAEALHGEHGDLASSVYMATLFALDRA
4tmkA           VIEGLEGAGKTTARNVVVETLEQLIRDMVFTREPGGTQLAEKLRSLLLDIKSVGITDKAEVLMFYAARVQ
1j90A           -IEGNIGSGKTTYLNHFEKYK----NDICLLTEPVEKWRNVNGVNLLMYKDPKKWAMPFQSYVTLTMLQS
1p5zB           -IEGNIAAGKSTFVNILKQLCEDVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYIRAQLASLNG
1uf9A           ------GSGKSTVAALLRSWVLDLDALAARARENKEEELKRLFPEAVVGGRLD-RRALARLVFSDPERLK
1knqA           ---------------------------------------------------------DGDFLHPRRNIEK
1e2hA           YIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHISAGDAAVVMTSAQITMGMPYA


                         .         .         *         .         .         .         .:140
query           HVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCLRPDLILLFDVPVRLGLQRA
1e2dA           EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGL---PKPDLVLFLQLQLADAAKRG
1g3uA           GAVHTIQGLCRGYDVVILDRYVASNAAYSAAAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERS
4tmkA           LVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKRA
1j90A           HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEEVQADLIIYLRTSPEVAYERI
1p5zB           KLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNLELDGIIYLQATPETCLHRI
1uf9A           ALEAVVHPEVRRLLXEELSRLEAPLVFLEI-----PLLFEKGWEGR------LHGTLLVAAPLEERVRRV
1knqA           MASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLICSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRL
1e2hA           VTDAVLAPHIGGALTLIFDRHPIAALLCYYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL


                         +         .         .         .         .         *         .:210
query           TTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLIDSSLPLTRVQEAIQKVIMAFLEENRDx
1e2dA           -----AFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE-
1g3uA           RGRAQARDNYERD-AELQQRTGAVYAELAAQWGGRWLVVGADVDPGRLAATL--------------
4tmkA           RARG-ELDRIEQESFDFFNRTRARYLELAAQ-DKSIHTIDATQPLEAVMDAIRTTVTHWVKE----
1j90A           RQRARSEESCVP--LKYLQELHELHIHQRRPQSCKVLVLDADLNL---------------------
1p5zB           YLRGRNEEQGIHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST----
1uf9A           XAR-SGLSREEVLARERAQXPEEEKRKRAT------WVLENTGSLEDLERALKAVLAELT------
1knqA           KAR-----KGHFFKTQMLVTQFETLQEPGADETD-VLVVDIDQPLEGVVASTIEVI----------
1e2hA           AKRQ---RPGERLDLAMLAAIRRVYGLLA-------------------------------------