[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58185.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qh3A.bssp"
#ERROR : Can't open dsspfile "1jt1A.bssp"
#ERROR : Can't open dsspfile "2gmnA1.bssp"
#ERROR : Can't open dsspfile "1x8gA.bssp"
#ERROR : Can't open dsspfile "1smlA.bssp"
#ERROR : Can't open dsspfile "1m2xA.bssp"
#ERROR : Can't open dsspfile "1ztcA1.bssp"
#ERROR : Can't open dsspfile "2i7xA1.bssp"
#ERROR : Can't open dsspfile "2q0iA1.bssp"
#ERROR : Can't open dsspfile "2az4A1.bssp"
#ERROR : Can't open dsspfile "1p9eA.bssp"
#ERROR : Can't open dsspfile "1xm8A.bssp"
#ERROR : Can't open dsspfile "1vjnA.bssp"
#ERROR : Can't open dsspfile "2i7tA1.bssp"
#ERROR : Can't open dsspfile "1wraA1.bssp"
#ERROR : Can't open dsspfile "1ww1A1.bssp"
#ERROR : Can't open dsspfile "1bc2A.bssp"
#ERROR : Can't open dsspfile "1a7tA.bssp"
#ERROR : Can't open dsspfile "2d0oB1.bssp"
#ERROR : Can't open dsspfile "1e5dA2.bssp"
#ERROR : Can't open dsspfile "2dkfA1.bssp"
#ERROR : Can't open dsspfile "1vmeA2.bssp"
#ERROR : Can't open dsspfile "1y44A1.bssp"
#ERROR : Can't open dsspfile "1un8A4.bssp"
#ERROR : Can't open dsspfile "1zkpA1.bssp"
#ERROR : Can't open dsspfile "2cfuA2.bssp"
#ERROR : Can't open dsspfile "2p97A1.bssp"

## Summary of PDB Search
:212
    2e-31  20%  1qh3A  [d.157.1.2] PROTEIN (HYDROXYACYLGLUTATHIONE HYDROLASE)
    8e-29  24%  1jt1A  [d.157.1.1] FEZ-1, CLASS B3 METALLO-BETA-LACTAMASE
    3e-28  21%  2gmnA1 [d.157.1.1] METALLO-BETA-LACTAMASE A:29 -- 292
    2e-24  15%  1x8gA  [d.157.1.1] BETA-LACTAMASE
    5e-24  18%  1smlA  [d.157.1.1] PROTEIN (PENICILLINASE)
    1e-23  13%  1m2xA  [d.157.1.1] CLASS B CARBAPENEMASE BLAB-1
    7e-22  18%  1ztcA1 [d.157.1.11] HYPOTHETICAL PROTEIN TM0894 A:1 -- 207
    8e-22  14%  2i7xA1 [d.157.1.10] PROTEIN CFT2 A:1 -- 422 A:626 -- 717
    2e-21  24%  2q0iA1 [d.157.1.14] QUINOLONE SIGNAL RESPONSE PROTEIN A:1 -- 298
    4e-21  14%  2az4A1 [d.157.1.10] HYPOTHETICAL PROTEIN EF2904 A:56 -- 238
    8e-21  20%  1p9eA  [d.157.1.5] METHYL PARATHION HYDROLASE
    8e-21  24%  1xm8A  [d.157.1.2] GLYOXALASE II
    8e-19  15%  1vjnA  [d.157.1.4] ZN-DEPENDENT HYDROLASE OF METALLO-BETA-LACTAMASE
    1e-18  12%  2i7tA1 [d.157.1.10] CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR
    3e-18  19%  1wraA1 [d.157.1.8] TEICHOIC ACID PHOSPHORYLCHOLINE ESTERASE/CHOLINE
    5e-18  17%  1ww1A1 [d.157.1.7] TRNASE Z A:1 -- 280
    3e-17  21%  1bc2A  [d.157.1.1] METALLO-BETA-LACTAMASE II
    1e-15  23%  1a7tA  [d.157.1.1] METALLO-BETA-LACTAMASE
    2e-13  10%  2d0oB1 [c.51.3.2] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL B:5 --
    2e-11  20%  1e5dA2 [d.157.1.3] RUBREDOXIN\:OXYGEN OXIDOREDUCTASE A:2 -- 250
    4e-10  26%  2dkfA1 [d.157.1.10] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN A:1
    3e-09  16%  1vmeA2 [d.157.1.3] FLAVOPROTEIN A:1 -- 250
    2e-08  25%  1y44A1 [d.157.1.7] RIBONUCLEASE Z A:1 -- 307
    3e-06  18%  1un8A4 [c.119.1.2] DIHYDROXYACETONE KINASE A:1 -- 335
    1e-05  29%  1zkpA1 [d.157.1.9] HYPOTHETICAL PROTEIN BA1088 A:1 -- 244
    4e-05  17%  2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524
    3e-04  38%  2p97A1 [d.157.1.12] HYPOTHETICAL PROTEIN A:1 -- 200
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
1qh3A           ---KVEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVK
1jt1A           ------PPFRIAGNLYYVGTDDLASYLIVTPRGNIPMIKASIKKLGFKFSDLLISHAHFDHAAGSELIKQ
2gmnA1          -------------AVYVI--KTSQGLILMDTAGMIKDNIAKLGFKVADIKLILNTHAHLDHTGGFAEIKK
1x8gA           --YVVEDNYYVQENSMVYFGA--KGVTVVGATWTPDTARELHKLSRKPVLEVINTNYHTDRAGGNAYWKS
1smlA           ---HTWQIGTEDLTALLVQTP--DGAVLLDGGSHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKR
1m2xA           ------NGTKYAANAVYLVTD--KGVVVIDCPKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGK
1ztcA1          ----FVPGRLNAHFSTVVYLEHKDRRIIIDPGDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFEN
2i7xA1          YKYNCCDDGSGTTVGSVVRFD--NVTLLIDPGWNYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYY
2q0iA1          -------------VFLLR--LGEASWALVEGGELVWADLCRWVADPSQVHYWLITHKHYDHCGLLPYLCP
2az4A1          -------------NNRLVP----ELKDLYDPRLGY--EYHGAEDKDYQHTAVFLSHAHLDHSRMINYLDP
1p9eA           -------------TGYLV--NTGSKLVLVDTGGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQ
1xm8A           MQIELVPC--LKDNYAYI-LHDEDTGTVGVVDSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKD
1vjnA           -------ITWFGHACFAL--EXEGKTIVTDPFDPIP---------NVTADVVTESHQHNAHHLVKGNFRV
2i7tA1          LLIRPLGAQEVGRSCIILEFK--GRKIMLDCGEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQ
1wraA1          NKIHFINVQEGGSDAIIL--ESNGHFAMVDTGLTDRVFRRLKELSVQKLDFILVTHTHSDHIGNVDELLS
1ww1A1          -----MNIIGFSKALFSTWIYYSPERILFDAG---EGVSTTLGSKVYAFKYVFLTHGHVDHIAGLWGVVN
1bc2A           -------------NGLVLNTSKG--LVLVDSSWDTKELIEMVEKKFKRVTDVIITHAHADRIGGIKTLKE
1a7tA           -------------------------AALLDTPAQTEMLVNWTDSLHAKVTTFIPNHWHGDCIGGLGYLQR
2d0oB1          --------------------------------------------------PAIAIAVIDGCDGLWREVLL
1e5dA2          ---------------------EDEKTTLFDTVKAKGELLCGIASVIKKIDYLVIQHLELDHAGALPALIE
2dkfA1          -------------SAHLL--LAGGRRVLLDCGXFQEEARNHAPFGFDEVDAVLLTHAHLDHVGRLPKLFR
1vmeA2          -------------NAYLV--KLNGANVLIDGWGNYAKEFIDALSKIVDPKEIIVNHTEPDHSGSLPATLK
1y44A1          -----IPAKARNVTSVALKLLEERRSVLFDCGEATQHQXLHTTIKPRKIEKIFITHXHGDHVYGLPGLGG
1un8A4          ----------------------------------------------------MSQFFFNQRTHLVSDV--
1zkpA1          --------------------EHDGFRLLVDCGSGVLAQLQKYITPS-DIDAVVLSHYHHDHVADIGVLGQ
2cfuA2          ----IYQVRGFDLNITFIRGD--SGWIVVDTLTTPATALVSRELGERPIRTVIYSHAHADHFGGVRGLVE
2p97A1          ---------------------------------------------------IVLTNS--DHVRSAKEIAD


                         .         .         *         .         .         .         .:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
1qh3A           LESGLKVYGGDDRIGA--------------------LTHKITHLSTLQVGSLNVKCLATPCHTSGHICYF
1jt1A           QTKAKYMVMD-EDVSVILSGGKSDFHYANDSSTYFTQDKVLHDGERVELGGTVLTAHLTPGHTRGCTTWT
2gmnA1          ETGAQLVAGERDKPLLEGGYYPGDEKNEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATPGHSPGCTSWE
1x8gA           I-GAKVVSTRQTRDLMKSDWAEIVAFLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIFVY
1smlA           RTGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAGHTPGSTAWT
1m2xA           IGAKTYSTKMTDSILAKE--------------NKPRAQYTFDNNKSFKVGSEFQVYYPGKGHTADNVVVW
1ztcA1          ATFY------VHEVYKTKNYLSFGTIVGYSKVISSWKNVVLLKGEESLFDE-KVKVFHTPWHAREHLSFL
2i7xA1          NFTSHFISRASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTLLAYNAGVCPGGSIWC
2q0iA1          RLNVQVLASERTCQAWKSESAVRVVEREACAWDALPVRAVADGEWLELGPRHRLQVIEAHGHSDDHVVFY
2az4A1          AVPLYTLKETKMILNSLNRKGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDAYGASLIR
1p9eA           LANAVVRADQKEADFWLSQTNLDKAPDDEASLNPYVKAGKFKPFSGNTDLVPGIKALASHGHTPGHYVVE
1xm8A           RYGAKVIGSAMDKDRIPG------------------IDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLY
1vjnA           IDRPGAYTVNGVKIKG--------------------VETFHDGKNIVFVFEGEGIKVCHLGDLGHVLTPA
2i7tA1          KFKGRTFMTHATKAIYRWLLSDYVKLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFM
1wraA1          TYPVDVYLKKYSDSRITNSERLWDNLYGYDKVTGVSVIQNITQGDAHQFGDMDIQLYNYENETDSSGELK
1ww1A1          IRNNGMGDREKPLDVFYPEGNRAVEEYTEFDLRFSFNVHPLKEGERVFLRNAGFKRYVQPFRTKSEVSFG
1bc2A           RGIKAHSTALTAEL---------AKKNGYE-----EPLGDLQTVTNLKFGNMKVETFYGKGHTEDNIVVW
1a7tA           K-GVQSYANQMTIDLAKE--------KGLP-----VPEHGFTDSLTVSLDGMPLQCYYGGGHATDNIVVW
2d0oB1          GIEEEG--------------------IPFRLQHHPAGEVVDSAWQAARSSPLLVGIACDRHMLVVHYK-N
1e5dA2          ACQ---PEKIFTSSLGQKAM---ESHFHYKD----WPVQVVKHGETLSLGKRTVTFYETRLHWPDSMVSW
2dkfA1          EYRGPVYATRLEDALKVXDEPFFGP---EDVEEALGHLRPLEYGEWLRLGALSLAFGQ-AGHLPGSAFVA
1vmeA2          TI--GHDVEIIASNFGKRLLEGFYGIKDVTVVK---------DGEEREIGGKKFKFVXTPWHWPDTXVTY
1y44A1          EDELTVYGPKGIKAFIETSLAVTKTHLTYP----------------------------------------
1un8A4          ----------------IDGAIIA-----SPWNNLARLES--DPAIRIVVNNVAVISGGGSGHEPAHVGFI
1zkpA1          LPELPIYGHTFDENGF------------------------------------------------------
2cfuA2          PQQVASGAVQIIAPAGFMEAAIVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGKGLARGPLSLLAPTRL
2p97A1          QTYTKIAGPVAEKE-------------NFP----IYCDRWLSDGDELVPGLKVXELQGS--KTPGELALL


                         +         .         .         .         .         *         .:210
query           HPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVGE
1qh3A           GSEPPAVFTGDTLFVAGCGKFYE--GTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEP---
1jt1A           MKLKDHGKQYQAVIIGSIGYKLVDNITYPKIAEDYKHSIKVLERCDIFLGSHAGMFDLKNKYQNNPFV--
2gmnA1          MTVKLFFCSGTVALNRLVGQPTYA-GIVDDYRATF-AKAKAMKIDV-LLGPHPEVYGMMKDGAPNPFI--
1x8gA           FPDEQVLYGNC-ILKEKLGNLSF--ADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPELID-------
1smlA           WTDPVRIAYADSLSAPGYQLQGNPRYPHLIDYRRSFATVRALPCDVLLTPHPGASN--------------
1m2xA           FPKEKVLVGGCIIKSADSKDLGYGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLI--
1ztcA1          ENAGRVLITGD-ITPNRLSYYDIIKGYGSVQVKNFLDRVGRI--DLLVFPHDAP----------------
2i7xA1          ISTYS----EKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITLDRFGSSQPFKKRSKIF---
2q0iA1          DVRRRRLFCGDALGEFDEAERPLVFDDMEAYLESL-ERLQRLPTLLQLIPGHG-----------------
2az4A1          TPDHFITYTGDLRLHGHNREETLAFCEKA-------KHTELLMMEGVSISFPEREPDPAQIAV-------
1p9eA           SQGQKLALLGDLILVAAVQFDDPSVTDSKSVAVERKKAFDAAKGGYLIAASHLSFPGIGHIRAEGKG---
1xm8A           FPGSRAIFTGDTMFSLSCG--KLFEGTPKQMLASL-QKITSLPDDTSIYCGHENSKFALSLEPNNEVLQS
1vjnA           QV--EEIGEIDVLLVPVGGTYTIGPKEAKEVADLLNAKVIIPXHYKTKYLKFNPVDDFLKLFDSYERVGN
2i7tA1          IEIAG----VKLLYTGDFSRQMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHD---------
1wraA1          KIWDDNSNSLISVVKVNGKKIYLG-GDLDNVHGADKYGPLIGKVDLMKFNHHHDTNKSNTKDF-------
1ww1A1          YHIFEVRRKFVTEEYH--KKVLTISGDSLALDPEEIRGTELLIHECTFLDARDNHAAIDE----------
1bc2A           LPQYNI-LVGGCLVKSTSAKDNVADAYVNEWSTSIENVLKRYRNINAVVPGHGEVGDKG-----------
1a7tA           LPTENILFGGCMLKDNQTSIGNISDADVTAWPKTLDKVKAKFPSARYVVPGHGN----------------
2d0oB1          LPASAPLFTLMHHQDSQAHR--NTGNNAARLVKGIPFR--------------------------------
1e5dA2          FADQNIA--ASERFSDQIPVHTLERAMYANIVNKAIETLVGAGVAPEFIPDHGV----------------
2dkfA1          QGEG-----RTLVYSGDLGNRE------------------------------------------------
1vmeA2          LDGGYLL--PEILDDSNESVVERYLPHIVTVIGHYKNYILEGAEKIKALPGHGL----------------
1y44A1          ----------------------------------------------------------------------
1un8A4          GKGMLTAAVCGDVFAS------------------------------------------------------
1zkpA1          ----------------------------------------------------------------------
2cfuA2          IEGEG-----------------------------------------------------------------
2p97A1          LEETTL-ITGDLV---------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KI
1qh3A           --
1jt1A           --
2gmnA1          --
1x8gA           --
1smlA           --
1m2xA           --
1ztcA1          --
2i7xA1          --
2q0iA1          --
2az4A1          --
1p9eA           --
1xm8A           YA
1vjnA           IL
2i7tA1          --
1wraA1          --
1ww1A1          --
1bc2A           --
1a7tA           --
2d0oB1          --
1e5dA2          --
2dkfA1          --
1vmeA2          --
1y44A1          --
1un8A4          --
1zkpA1          --
2cfuA2          --
2p97A1          --