[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58418.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1md9A.bssp"
#ERROR : Can't open dsspfile "1pg3A.bssp"
#ERROR : Can't open dsspfile "1ultA.bssp"
#ERROR : Can't open dsspfile "1ba3A.bssp"
#ERROR : Can't open dsspfile "1t5dX.bssp"
#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "3btaA2.bssp"
#ERROR : Can't open dsspfile "1wmxA.bssp"
#ERROR : Can't open dsspfile "1o65A.bssp"
#ERROR : Can't open dsspfile "1f53A.bssp"
#ERROR : Can't open dsspfile "1f05A.bssp"
#ERROR : Can't open dsspfile "2imlA1.bssp"
#ERROR : Can't open dsspfile "1dl3A.bssp"
#ERROR : Can't open dsspfile "2qtpA1.bssp"
#ERROR : Can't open dsspfile "2nr4A1.bssp"
#ERROR : Can't open dsspfile "1zpdA1.bssp"
#ERROR : Can't open dsspfile "2fsuA1.bssp"
#ERROR : Can't open dsspfile "1ktbA1.bssp"
#ERROR : Can't open dsspfile "1hf2A1.bssp"
#ERROR : Can't open dsspfile "1oi0A.bssp"
#ERROR : Can't open dsspfile "1opmA2.bssp"
#ERROR : Can't open dsspfile "2vnuD3.bssp"
#ERROR : Can't open dsspfile "1jrmA.bssp"
#ERROR : Can't open dsspfile "1aa1B2.bssp"

## Summary of PDB Search
:538
    4e-72  21%  1md9A  [e.23.1.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    3e-61  20%  1pg3A  [e.23.1.1] ACETYL-COA SYNTHETASE
    6e-61  24%  1ultA  [e.23.1.1] LONG CHAIN FATTY ACID-COA LIGASE
    3e-60  20%  1ba3A  [e.23.1.1] LUCIFERASE
    4e-60  21%  1t5dX  [e.23.1.1] 4-CHLOROBENZOYL COA LIGASE
    3e-58  22%  1amuA  [e.23.1.1] GRAMICIDIN SYNTHETASE 1
    2e-22   9%  3btaA2 [b.42.4.2] PROTEIN (BOTULINUM NEUROTOXIN TYPE A) A:1079 --
    3e-22  11%  1wmxA  [b.18.1.24] COG3291: FOG: PKD REPEAT
    9e-22   8%  1o65A  [b.58.1.2] HYPOTHETICAL PROTEIN YIIM
    2e-21  15%  1f53A  [b.11.1.4] YEAST KILLER TOXIN-LIKE PROTEIN
    3e-20   8%  1f05A  [c.1.10.1] TRANSALDOLASE
    1e-18   9%  2imlA1 [b.45.1.4] HYPOTHETICAL PROTEIN A:1 -- 189
    2e-18  11%  1dl3A  [c.1.2.4] PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
    5e-16  10%  2qtpA1 [d.79.9.1] UNCHARACTERIZED PROTEIN A:3 -- 171
    7e-16   6%  2nr4A1 [b.45.1.4] CONSERVED HYPOTHETICAL PROTEIN A:19 -- 210
    1e-15   9%  1zpdA1 [c.31.1.3] PYRUVATE DECARBOXYLASE A:188 -- 362
    8e-15  10%  2fsuA1 [c.67.2.1] PROTEIN PHNH A:12 -- 194
    1e-14  14%  1ktbA1 [b.71.1.1] ALPHA-N-ACETYLGALACTOSAMINIDASE A:294 -- 388
    9e-14  11%  1hf2A1 [b.80.3.1] SEPTUM SITE-DETERMINING PROTEIN MINC A:100 -- 206
    3e-13  13%  1oi0A  [c.97.3.1] HYPOTHETICAL PROTEIN AF2198
    1e-12  10%  1opmA2 [b.121.1.2] PROTEIN (PEPTIDYLGLYCINE ALPHA-HYDROXYLATING
    2e-11   5%  2vnuD3 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:252 -- 399
    5e-04  15%  1jrmA  [d.206.1.1] CONSERVED HYPOTHETICAL PROTEIN MTH637
    0.001  33%  1aa1B2 [d.58.9.1] RIBULOSE BISPHOSPHATE CARBOXYLASE (LARGE CHAIN)
:538

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRIHSANSLVHSLVLDNALKGPDASALVHGDQTLTYASLGETVXXXXXXXXXXXXXXXXXVAIYLPKRP
1md9A           ----------FGDLLRDRAAKYGDRIAITCGNTHWSYRELDTRADRLAAGFQKLGIQQKDRVVVQLPNIK
1pg3A           ----------AANCLDRHLQENGDRTAIISQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVP
1ultA           ----------LWDFLERAAALFGRKEVVSRLHHRTTYAEVYQRARRLMGGLRALGVGVGDRVATLGFNHF
1ba3A           ---------------MKRYALVPGTIAFTDAEVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSL
1t5dX           ----------VNEMLRRAATRAPDHCALAVPARGLRLAELRARVEAVAARLHADGLRPQQRVAVVAPNSA
1amuA           ----YPRDKTIHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSI
3btaA2          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1f53A           ----------------------------------------------------------------------
1f05A           ------------------KKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDR-ILIKLSSTW
2imlA1          ----------------------------------------------------------------------
1dl3A           MVRVKICGITNLEDALFSVESGADYVGFVFYPKSKRYISPEDARRISVELPVER-------VGVFVNEEP
2qtpA1          ----------------------------------------------------------------------
2nr4A1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
2fsuA1          ----------------------------------------------------------------------
1ktbA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1opmA2          ----------------------------------------------------------------------
2vnuD3          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------
1aa1B2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ETVVTLFXXXXXXXVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFLQDALAECHDLRSLVIVDAPT
1md9A           EFFEVIFALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIIPDAYSGF---------DYRSLARQVQSK
1pg3A           EAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTS
1ultA           RHLEAYFAVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNLLPLVEAIRGELKTVQHFVVMDEK-
1ba3A           QFFMPVLGALFIGVAVAPANDIYNERELLNSMNISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKT
1t5dX           DVVIAILALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIF--QSGSGARIIFLGDLV
1amuA           DLFIGILAVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLIHNIQFNGQVEIFEEDTIKI-
3btaA2          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1f53A           ----------------------------------------------------------------------
1f05A           EGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSV
2imlA1          ----------------------------------------------------------------------
1dl3A           EKILDVASYVQLNAVQLHGEEPIELCRKIAERILVWKAVGVSNERDMERALNYREFPILL----------
2qtpA1          ----------------------------------------------------------------------
2nr4A1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
2fsuA1          ----------------------------------------------------------------------
1ktbA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1opmA2          ---------------------------------IAGMYLMMSVDTVIDISCQYKMYPMHVFAYRVHTHHL
2vnuD3          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------
1aa1B2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAILYTSGSTGRPKGVVLSHRNLVAGAQSVAQYL
1md9A           LPTLKNIIVAGEAEEFLPLEDLHTEPVKLPEVKSDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVC
1pg3A           TGSDIDWQEGRDLWWRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATTFKYVF
1ultA           ------APEGYLAYEEALG----EEADPVRVPERAACGMAYTTGTTGLPKGVVYSHRALVSLAASLVDGT
1ba3A           D--YQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSTGLPKGVALPHRTACVRFSHARDGN
1t5dX           RDGEPYSYGPPIEDPQ----------------REPAQPAFIFYTSTGLPKAAIIPQRAAESRVLFMSTQV
1amuA           --------------------------REGTNLHVPSKSTDLAYVIYTSPKGTMLEHKGISNLKVFFENSL
3btaA2          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1f53A           ----------------------------------------------------------------------
1f05A           TKIYNYYKKFSYKTIVMGASFRNLAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDERW
2imlA1          ----------------------------------------------------------------------
1dl3A           --------DTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVR----PFAVDVSSGVEAFGKKDHDSIK
2qtpA1          ----------------------------------------------------------------------
2nr4A1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
2fsuA1          ----------------------------------------------------------------------
1ktbA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1opmA2          GKVVSGYRVRNGQWTLIGR-----QNPQLPQAFYPVEHPVVTFGDILAARCVFTGEGRTEA-THIGGTSS
2vnuD3          ----------------------------------------------------------------------
1jrmA           ------------------------------------RDVEIVSGQKSRQKTIRIQGMGRDLFLKLVSEKF
1aa1B2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ENNSNDRLLAVLPLSFDAGFSQLTTAFSVGASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLA
1md9A           WLDHSTVYLAALPXAHNYPLSSPLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAXVWXDAA
1pg3A           DYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFWPTPARMCQVVDKHQVNILYTAPTAIRALMAEG
1ultA           ALSEKDVVLPVVPMFHVNAWCLPYAATLVGKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALADYL
1ba3A           QIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFAKSTL
1t5dX           GLRRHNVVLGLMPLYHVVGFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAA
1amuA           NVTEKDRIGQFASISFDASVWEMFMALLTGASLYIITINDFVKFEQYINQKEITVITLPPTYVVHLDPER
3btaA2          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1f53A           ----------------------------------------------------------------------
1f05A           LHNEDQEKLSDGIRKFAADAVKL-----------------------------------------------
2imlA1          ----------------------------------------------------------------------
1dl3A           MFIKNAK---------------------------------------------------------------
2qtpA1          -----------------------------------IRKIAVFIEETRIEAGREISPPTRKAVAVAVIENP
2nr4A1          ----------------------------------------------------------------------
1zpdA1          ----------------------------------------------------------------------
2fsuA1          --------------------------------------------------RRLLKAXSEPGVIVALHQLK
1ktbA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1opmA2          DEMCNLYIMYYMEAKYALSFM---TCTKNVAPDMFRTIAEANIPI-------------------------
2vnuD3          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------
1aa1B2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WPPEAADTLRYIANTGGRMPKAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNV
1md9A           SSRDDLSSLQVLQVGGAKFSAEAARRVKAVFGCT-LQQVFGXAEGLVNYTRLDDPEEIIVNTQGKPXPYD
1pg3A           DKAIEGTDRSILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGITPLPGAIELKAGSATRPFFGV
1ultA           STGHRLKTLRRLVVGGSAAPRSLIARFER--MGVEVRQGYGLTETSPVVVQNFEEKLTLKAKTGLPIPLV
1ba3A           IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFE
1t5dX           GSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGE-KVNIYGTTEAMNSLYMRQPK-TGTEMAPGFFSEVR
1amuA           ILSI-----QTLITAGSATSPSLVNKWKEKVTYINAY-GPTETTICATTWVATKETIGHSVPIGAPIQNT
3btaA2          ------------------------------------------KEI-KDLYDNQSNSGILKDFWGDYLQYD
1wmxA           ------------------------------------------------------DVQIFKDSPVVGWSGS
1o65A           ---------------------------------------------------------------------V
1f53A           ----------------------------------------------------------------------
1f05A           ----------------------------------------------------------------------
2imlA1          ---------------------------------------------------------LADFGFTDGINEI
1dl3A           ----------------------------------------------------------------------
2qtpA1          FAGRYVEDLTELXDTGAELGALLGERCVQALGIRPEQA---------ESYGKSAXVGENGELEHAAAILH
2nr4A1          -----------------------------------------------------------PIGIVMKGERP
1zpdA1          -------------------------------------------------------------------EAS
2fsuA1          -RGWQPLNIATTSVLLTLADNDTPVWLSTPLN-NDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEIL
1ktbA1          ----------------------------------------------------------------------
1hf2A1          ----------------------------------------------------------------------
1oi0A           ----------------------------------------------------------------------
1opmA2          ----------------------------------------------------------------------
2vnuD3          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------
1aa1B2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EIQVAREDGSLCLPGESGELVHRGVLVAMGYWNDPKKTAERFRPTPGQPPELPLTEIAVWSGDTVRMDED
1md9A           ESRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASFTEDGFY-----------RTGDIVRLTRD
1pg3A           QPALVDNEGHPQEGATEGNLVITDPGQARTLFGDHERFEQTYFSTFKNMY---------FSGDGARRDED
1ultA           RLRVADEEGRPVPKDGKGEVQLKGPWITGGYYGNEEATRSALTPDGFF-----------RTGDIAVWDEE
1ba3A           AKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDG-----------WLHSGDIAYWDED
1t5dX           IVRIGGGVDEIVANGEEGELIVAASDSAFVYLNQPQATAEKLQDGWY------------RTSDVAVWTPE
1amuA           QIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNPFVP-----GEKLYKTGDQARWLSD
3btaA2          KPYYMLNLY------DPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYR-----GTKFIIKKYAS
1wmxA           GMGELETIG----DTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVEN--GYLEF
1o65A           EREQMRYPV-DVYTGKAKIQVDGELMLTQAVHGGPDRALCHYPREH-------------YLYWAREFPEQ
1f53A           -------------PCRGGENFLKIWSHSGGQQSVDCYANRGRIDFGGWWVD----KISTGNNDLIYYDAN
1f05A           ----------------------------------------------------------------------
2imlA1          IAITENEDGSAAPIGIIVEDSSSDTAKAKLYRNRTRANLERSGVLFANVTDDALVFAVSYASPNPPIIKG
1dl3A           ----------------------------------------------------------------------
2qtpA1          PKLLVPSSKKXGSPGQVLDVPLGHFDGIEVRLNDAPRANEI-----------------------------
2nr4A1          FVRLFKGSHTWENVLKEKCLASNVVYDPILFVRSTFSDLVPSEFE------------YVDGEFKFPVLKE
1zpdA1          LNAAVDETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFTD------------ALGGAVATMAAAKSFFPE
2fsuA1          QVASLSGGRXLRLTGEERIAPQLPECILHELTERPHPFPLGI---DL------------ICGERLLAIPR
1ktbA1          ------IQGRRIIKEGSHIEVFLRPLSALVFFSRRTDMPFRYTTS------------LAKLGFPMGAAYE
1hf2A1          --------KVIKRNIRSGQTVVHSGDVIVFGNVNK--GAEILA-----------GGSVVVFGKAQGNIRA
1oi0A           ----------------------------------------------------------------------
1opmA2          ----------------------------------------------------------------------
2vnuD3          --------------------------TFPEYYSTAR-VXGGLKNG------------VLYQGNIQISEYE
1jrmA           ----------------------------------------------------------------------
1aa1B2          ----------------------------LTYYTETLDTAFRVSPQPGVPPEEAAAESSTGTWTTVWTDGL


                         .         .         +         .         .         .         .:490
query           GFFYFIGRQDEMIKTSGYRVSPTEVEEVLYQXXXXXXXXXXXXXHPKLGQGIVAIVKPNKDNFDPEDLLA
1md9A           GYIVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDAAXVSXPDQFLGERSCVFIIPRDEAPKAAELKA
1pg3A           GYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELRN
1ultA           GYVEIKDRLKDLIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTPEELNH
1ba3A           EHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEPAAVVVLEHGKTMTEKEIVD
1t5dX           GTVRILGRVDDMIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTAVPRLGETLSADALDTF
1amuA           GNIEYLGRIDNQVKIRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKH-IPLEQLRQ
3btaA2          GNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKMNLQDNNGNDIGF
1wmxA           DIKGKEGGEDFVIGFRDKVYERVYGLEID-VTTVISNYVTVTTDWQHVKIPLRDLMKI-NNGFDPSSVT-
1o65A           AESTDGLTESNVYMGDIFRWGEALIQVSQPRSPCYKLNYHFDISDIAQLMQNTGKVVSRVSDVTVQEAAA
1f53A           GDSVRVDRWHDITY----PNRPPKVNSIE-----------------------------------------
1f05A           ----------------------------------------------------------------------
2imlA1          AXAWCRFEAEXRSGVAHLKLTDGEIIEKRVRAINRGLSAVIEALVHATRYV----------AIKSDERRK
1dl3A           ----------------------------------------------------------------------
2qtpA1          ----------------------------------------------------------------------
2nr4A1          AIAWVVFECINLRNTDQSLVADLVPLNAGFNERNIKELPVPNRGFNAVLEATVHATRYQTGEEKYLELIR
1zpdA1          ENALYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLA------EPRSVVVNG
2fsuA1          T---------------------------------------------------------------------
1ktbA1          VQDVYSGKIISGLKTGDNFTVIINPSGVV-----------------------------------------
1hf2A1          GL---NEGGQAVVAALDLQTSLIQIAGFITHSKGEENVPSIAHVKG-NRIVIEPFD--------------
1oi0A           ------RGLLKTILEAAKSAHPDEFIALLSG-SKDVMDELIFLPFVSIGMKVFGTVHSHPSPSSEEDLSL
1opmA2          ----------------------------------------------------------------------
2vnuD3          GSVSLPRFSKPVLIVGQKNLNRAFNGDQVI---------VELLPQSEWKAPSSIVLDSEHDIQPTAKVVY
1jrmA           ----------------------------------------------------------------------
1aa1B2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TCRAELPNFMVPLAVIVSENLPRNTNGKIDRRALAMEFELLFKEQTAP
1md9A           FLRERGAAYKIPDRVEFVESFPQTGVGKVSKKAL--------------
1pg3A           WVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRK----IAAGDLAD
1ultA           LLKAGFAKWQLPDAYVFAEEIPRTSAGKFLKRALREQYK---------
1ba3A           YVASQVTAKKLRGGVVFVDEVPKGLTGKLDARKIREILI---------
1t5dX           CRSSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQVS---------
1amuA           FSSEELPTYMIPSYFIQLDKMPLTSNGKIDRKQLEPDLTFF-------
3btaA2          IGFHQFNNIAKLVASNWYNRQIERSSRTLG------------------
1wmxA           -CLVFSKRYADPFTVWFSD-IKITS-----------------------
1o65A           IAWHMPFDDDQYHRLLSAAGLSKSWTRTMQKRRLSGKIEDFSRRLWGK
1f53A           ------------------------------------------------
1f05A           ------------------------------------------------
2imlA1          ELLERIHYYREIV-----QKCGSEREKRAFEII---------------
1dl3A           ------------------------------------------------
2qtpA1          ------------------------------------------------
2nr4A1          HYESLASKCGGD------------AEKKAMKLIY--------------
1zpdA1          IRFPSVHLKDYLTRLAQK--VSKKTGSLDFFKSLN-------------
2fsuA1          ------------------------------------------------
1ktbA1          ------------------------------------------------
1hf2A1          ------------------------------------------------
1oi0A           FTRFGKYHIIVCYPYDENSWKCYNRKGEEVELEV--------------
1opmA2          ------------------------------------------------
2vnuD3          IQR---------------------------------------------
1jrmA           ------------------------------------------------
1aa1B2          ------------------------------------------------