[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58511.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pdnC.bssp"

## Summary of PDB Search
:111
    7e-04  17%  1pdnC  [a.4.1.5] PROTEIN (PRD PAIRED)
:111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYERPGPRRSHKxxxxxxxxxxxx
1pdnC           ----PNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSK------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pdnC           -----------------------------------------