[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58609.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1shtX.bssp"

## Summary of PDB Search
:238
    2e-04  14%  1shtX  [c.62.1.1] ANTHRAX TOXIN RECEPTOR 2
:238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIFAMDATASREPTWDRACHIQAQMFQETAS
1shtX           ---------------------------------------LYFVLDKSGSVANNWEIYNFVQQLAERFVSP


                         .         .         *         .         .         .         .:140
query           LGGLEIQLCYYRGFKEFSASSWLRHSDALLKQMNTVACRGGYTQIEKALQHTQNETRKQKVNALVFVGDC
1shtX           EMRLSFIVFSSQATIILPLTGD-RGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKASIIIALTDGKL


                         +         .         .         .         .         *         .:210
query           MEEKMERLCHMAGELGILGVPAFVFQEGYDLVAERAFRQIAQLTQGAYCRFDAASAAQLRDLLNAVxxxx
1shtX           DGLVPSYAEKEAKISRSLGASVYCV--GVLDFEQAQLERIADSKEQVF--PVKGGFQALKGIINSI----


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
1shtX           ----------------------------