[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58831.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wlgA.bssp"

## Summary of PDB Search
:261
    7e-18  33%  1wlgA  [b.152.1.1] FLAGELLAR HOOK PROTEIN FLGE
:261

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wlgA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSLAYTRDGTFQIDANGQLVTSSGYPVQPGI
1wlgA           ----------------------------------------SLSFLNSMQQNTGANNIVATNQGYK-----


                         +         .         .         .         .         *         .:210
query           TIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFINPAGLQPTGNNLFKETASSGVAQTGIPGLNG
1wlgA           --PGDLVSYQINNDGTVVGNY-SNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGN


                         .         .         .         +         .         .         .:280
query           IGTLVQGALEGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wlgA           FGKLTNGALEA----------------------------------------