[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58871.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2arkA1.bssp"
#ERROR : Can't open dsspfile "1ydgA.bssp"
#ERROR : Can't open dsspfile "1zwkA1.bssp"
#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "1tllA2.bssp"
#ERROR : Can't open dsspfile "1akqA.bssp"
#ERROR : Can't open dsspfile "1t0iA.bssp"
#ERROR : Can't open dsspfile "1ag9A.bssp"
#ERROR : Can't open dsspfile "2fzvA1.bssp"
#ERROR : Can't open dsspfile "1vmeA1.bssp"
#ERROR : Can't open dsspfile "1t5bA.bssp"
#ERROR : Can't open dsspfile "1ykgA1.bssp"
#ERROR : Can't open dsspfile "1rliA.bssp"
#ERROR : Can't open dsspfile "1amoA2.bssp"
#ERROR : Can't open dsspfile "1e5dA1.bssp"
#ERROR : Can't open dsspfile "1rljA.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "1flaA.bssp"
#ERROR : Can't open dsspfile "1nni1.bssp"
#ERROR : Can't open dsspfile "1sqsA.bssp"
#ERROR : Can't open dsspfile "2eyqA6.bssp"

## Summary of PDB Search
:200
    3e-46  33%  2arkA1 [c.23.5.8] FLAVODOXIN A:1 -- 184
    7e-43  37%  1ydgA  [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA
    2e-39  44%  1zwkA1 [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA A:4 -- 196
    5e-25  13%  1rttA  [c.23.5.4] CONSERVED HYPOTHETICAL PROTEIN
    2e-24  12%  1tllA2 [c.23.5.2] NITRIC-OXIDE SYNTHASE, BRAIN A:750 -- 951
    8e-23  17%  1akqA  [c.23.5.1] FLAVODOXIN
    1e-22  14%  1t0iA  [c.23.5.4] YLR011WP
    2e-22  17%  1ag9A  [c.23.5.1] FLAVODOXIN
    4e-22  14%  2fzvA1 [c.23.5.4] PUTATIVE ARSENICAL RESISTANCE PROTEIN A:1 -- 233
    2e-19  21%  1vmeA1 [c.23.5.1] FLAVOPROTEIN A:251 -- 398
    5e-19  21%  1t5bA  [c.23.5.3] ACYL CARRIER PROTEIN PHOSPHODIESTERASE
    5e-19  14%  1ykgA1 [c.23.5.2] SULFITE REDUCTASE [NADPH] FLAVOPROTEIN ALPHA-
    3e-18  17%  1rliA  [c.23.5.6] TRP REPRESSOR BINDING PROTEIN
    1e-14  14%  1amoA2 [c.23.5.2] NADPH-CYTOCHROME P450 REDUCTASE A:64 -- 235
    2e-13  26%  1e5dA1 [c.23.5.1] RUBREDOXIN\:OXYGEN OXIDOREDUCTASE A:251 -- 402
    4e-13  14%  1rljA  [c.23.5.7] NRDI PROTEIN
    5e-10  11%  1d4aA  [c.23.5.3] QUINONE REDUCTASE
    1e-07  27%  1flaA  [c.23.5.1] FLAVODOXIN
    8e-06  15%  1nni1  [c.23.5.4] HYPOTHETICAL PROTEIN YHDA
    1e-05  25%  1sqsA  [c.23.5.5] CONSERVED HYPOTHETICAL PROTEIN
    1e-04  22%  2eyqA6 [d.315.1.1] TRANSCRIPTION-REPAIR COUPLING FACTOR A:990 --
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
2arkA1          --KVLVIYDTRTGNTKKXAELVAEGARSLEGTEVRLKHVDE--------------------ATKEDVLWA
1ydgA           -VKLAIVFYSSTGTGYAMAQEAAEAGRAAG-AEVRLLKVRETAPQDVIDGQDAWKAKDVPEATPADLEWA
1zwkA1          --YILVLYYSRHGATAEMARQIARGVEQ-GGFEARVRTVPAVSTEGA------------LYATLEDLKNC
1rttA           --KVLGISGSLRSYNSAALQEAIGLVP--PGMSIELADISGIPLYNEDVYALGF--PPAVERFREQIRAA
1tllA2          --KATILYATETGKSQAYAKTLCEIFK--HAFDAKAMSMEEYDIVHLEHEALVLVV--TSTFGNGDPPEN
1akqA           --KALIVYGSTTGNTEYTAETIARELAD-AGYEVDSRDAASVEAG-------------------GLFEGF
1t0iA           --KVGIIMGSVKRVCPEIAAYVKRTIENSQKLKIQVVDLQQIALPLYQIKSVDEYADSKTRSWSRIVNAL
1ag9A           --ITGIFFGSDTGNTENIAKMIQKQLGK----------------------DVAD-VHDIAKSSKEDLEAY
2fzvA1          PVRILLLYGSLRSFSRLAVEEAARLLQF-FGAETRIFDPSDLPLPDQVQSDDHPAVKEL----RALSEWS
1vmeA1          --KVTVIYDSXYGFVENVXKKAIDSLKE-KGFTPVVYKFSDEERPAISE-------------ILKDIPDS
1t5bA           MSKVLVLKSSIYSQSGQLTDYFIEQWREHVADEITVRDLAANPVPVLDLTPRQQDALALSDELIAELKAH
1ykgA1          ---ITIISASQTGNARRVAEALRDDLLA-AKLNVKLVNAGD--------------------YKFKQIASE
1rliA           --KIAVINGGTRGNTDVLAEKAVQGFDA-EHIYLDYDSI------------------------IERILQC
1amoA2          GRNIIVFYGSQTGTAEEFANRLSKDAHR-YGMRGMSADPEEYDLAD--------------LSSLPEIDKS
1e5dA1          --KVVIFYDSMWHSTEKMARVLAESFRD-EGCTVKLMWCKACHHSQI----------------MSEISDA
1rljA           NAMVQIIFDSKTGNVQRFVNKTGFQQ------------------------------IRKVDEMDHV--DT
1d4aA           ------------GWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLVAEQKKLEAA
1flaA           -----IVYWSGTGNTEKMAELIAKGIIE-SGKDVNTINVSD--------------------VNIDELLNE
1nni1           ---------------RIAASYIAALYH-TDLIDLSEFVLP-VFNGEAEQSELLKVQELK-----QRVTKA
1sqsA           -----------------------------------------------------------------ELLES
2eyqA6          -----------------------LEDLTSQQTEVELR-MPSLLPDDFIPDVNTRLSFYKRIASAKTENEL


                         .         .         *         .         .         .         .:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
2arkA1          DGLAVGSPTNXGLVSWKXKRFFDDVGDLW--GEIDGKIACAFSSSGGWGGGNEVACXSILTXLXNFGFLV
1ydgA           EAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVL
1zwkA1          AGLALGSPTRFGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSMLLPLLHHGMLV
1rttA           DALLFATPEYNYSMAGVLKNAIDWASRPPEQPFSGKPAAILGASAGRFGTAR--AQYHLRQTLVFLDVHP
1tllA2          GEKFGCALMEMRHEERKSYKVRFNSVSGP----LANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGER
1akqA           DLVLLGCSTWGDDSIELQDDFIPLFDSLE-ETGAQGRKVACFGCGASSYEYFCGAVDAIEEKLKNLGAEI
1t0iA           DIIVFVTPQYNWGYPAALKNAID-----RLYHEWHGKPALVVSYG---GHGGSKCNDQLQEVLHGLKMNV
1ag9A           DILLLGIPTYYGEAQCDWDDFFPTLEEID----FNGKLVALFGCGDQEDYAEYFALGTIRDIIEPRGATI
2fzvA1          EGQVWCSPERHGQITSVMKAQIDHLPLEMAGRPTQGRTLAVMQVSGGSQSFN--AVNTLRLLGRWMRMFT
1vmeA1          EALIFGVSTYEAEIHPLXRFTLLEII----DKANYEKPVLVFGVHGWAPSAERT----------------
1t5bA           DVIVIAAPMYNFNIPTQLKNYFDLYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIALKVFLGFIGITD
1ykgA1          KLLIVVTSTQGGEPPEEAVALHKFLFSKK-APKLENTAFAVFSLGDTSYEFFCQSGKDFDSKLAELGGER
1rliA           HILIFATPIYWFGMSGTLKLFIDRWSQTLRKQQMSVKQAYVIAVGGDNPKIKGPLIQQFEHIFHFMGMSF
1amoA2          LVVFCMATYGEGDPTDNAQDFYDWLQETDV--DLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQR
1e5dA1          GAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGS------------------------------
1rljA           PFVLVTYTTNFGQVPASTQSFLE-----KYAHLLLGVAASGNKVWGDNFAKSADTISRQYQVPILHKFEL
1d4aA           DLVIFQFPLQWFGVPAILKGWFERYAAMYDKGPFRSKKAVLSITTMYSLQGIHGDMNVILWPIQSGILHF
1flaA           DILILGCSA-MDDEESEFEPFIEE-----ISTKISGKKVALFGS--------------------------
1nni1           DAIVLLSPEYHSGXSGALKNALDFLSSEQFKY--------------------------------------
1sqsA           DIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAES--NGSDNVSEYLRDIFSYXGGQI
2eyqA6          EEIKVELIDRFGLLPDPARTLLDIARLRQQAQKL------------------------------------


                         +         .         .         .         .         *         .:210
query           VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE
2arkA1          FGVTD-------YVGKKFTLHYGAVV-----AGEPRSEEEKEACRRLGRRLAEWVAIFVD
1ydgA           TPPGYTDEVI----FKSGGNPYGASVTANGQ---PLLENDRASIRHQVRRQVELTAKLLE
1zwkA1          LGI---------------PTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKL--
1rttA           LNKPE-------------------------------------------------------
1tllA2          ILKMREGDELCGQEEAF-------------------------------------------
1akqA           VQDGLRIDGDPRAAR---------------------------------------------
1t0iA           IGGVA-------VKIPVGTIPLPEDIVPQLSVHNEEILQLL-------------------
1ag9A           VGHWPTAGYHFEASKGLADDDHFVGLAID----------EDRQPELTAERVEKWVKQISE
2fzvA1          IP--------------NQSSIAKAFQEFDAAGRMKP-SPYYDRIADVMEELVRFTAL---
1vmeA1          ------------------------------------------------------------
1t5bA           VNFVFAE-----------------------------------------------------
1ykgA1          LLDRVDA-----------------------------------------------------
1rliA           KGYVL-------------------------------------------------------
1amoA2          IF----------------------------------------------------------
1e5dA1          ------------------------------------------------------------
1rljA           SG----------------------------------------------------------
1d4aA           CGFQV-------------------------------------------------------
1flaA           ------------------------------------------------------------
1nni1           ------------------------------------------------------------
1sqsA           ------------------------------------------------------------
2eyqA6          ------------------------------------------------------------