[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58880.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mzbA.bssp"
#ERROR : Can't open dsspfile "2g9wA1.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "1jhfA1.bssp"
#ERROR : Can't open dsspfile "3bz6A2.bssp"
#ERROR : Can't open dsspfile "2co5A1.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1stzA1.bssp"
#ERROR : Can't open dsspfile "1fp2A1.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "1yg2A.bssp"

## Summary of PDB Search
:163
    2e-22  19%  1mzbA  [a.4.5.42] FERRIC UPTAKE REGULATION PROTEIN
    6e-10  21%  2g9wA1 [a.4.5.39] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 124
    2e-06  26%  1dpuA  [a.4.5.16] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    3e-06  19%  1jhfA1 [a.4.5.2] LEXA REPRESSOR A:2 -- 72
    1e-05  22%  3bz6A2 [a.4.5.75] UPF0502 PROTEIN PSPTO_2686 A:97 -- 180
    2e-05  12%  2co5A1 [a.4.5.48] VIRAL PROTEIN F93 A:5 -- 93
    2e-05  16%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    4e-05  16%  1stzA1 [a.4.5.51] HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR HRCA A:14
    5e-04  11%  1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
    6e-04  10%  1aoyA  [a.4.5.3] ARGININE REPRESSOR
    6e-04  11%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
    7e-04  23%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 -- 80
    9e-04  29%  1yg2A  [a.4.5.61] GENE ACTIVATOR APHA
:163

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxAEKTCASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
1mzbA           ---------------------------ENSELRKAGLKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAG
2g9wA1          ----------------------------------KLTRLGDLERAVXDHLWSRTEPQTVRQVHEAL-SAR
1dpuA           -----------------------------------ANGLTVAQNQVLNLIKARPEGLNFQDLKNQL----
1jhfA1          --------------------------------------LTARQQEVFDLIRDHISQTGMPPTRAEIAQRL
3bz6A2          ----------------------------------KGLELVPAQVILTGLLL-LRGPQTVSELLTRSNRXH
2co5A1          -------------------------------------YMRINYYIILKVLVINGSRLEKKRLREILKRFD
1p6rA           ----------------------------------KIPQISDAELEVMKVIWK-HSSINTNEVIKELSKTS
1stzA1          -------------------------------------KLNDRQRKVLYCIVREYIENKKPVSSQRVLEVS
1fp2A1          --------------------------------IDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPS
1aoyA           ---------------------------------RSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGF
2fnaA1          -------------------------------------EIARKRYLNIXRTLSKCGKWSDVKRALELEEGI
1z05A1          --------------------------------------KQINAGRVYKLID-QKGPISRIDLSKESEL--
1yg2A           -----------------------------------------LPHVILTVLSTR--DATGYDITKEFSAYF


                         .         .         *         .         .         .         .:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAK
1mzbA           EDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADS-GHHDHMVCVDTGEVIEFMDAEIEKRQKEIVR
2g9wA1          RDLAYTTVXAVLQRLAKKNLVLQIRAHRYAPVHGRDELVLXVDALAQAEDSGSRQ---------------
1dpuA           KHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD------------------------------------
1jhfA1          GFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE---------------------------------
3bz6A2          DFEDSEQVVHQLERLIARGLATLV----------------------------------------------
2co5A1          IDISDGVLYPLIDSLIDDKILREEE---------------------------------------------
1p6rA           TWS-PKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDESD------------------------------
1stzA1          NEFSSATIRNDMKKLEYLGYIYQPHTSAGRIPTDKGLRFYYEEMLKISK---------------------
1fp2A1          --SKIGNVRRLMRYLAHNGFFEIIT---------------------------------------------
1aoyA           DNINQSKVSRMLTKFGAVRTRNAK----------------------------------------------
2fnaA1          EIS-DSEIYNYLTQLTKHSWIIKE----------------------------------------------
1z05A1          ---APASITKITRELIDAHLIHETTVQEAIS---------------------------------------
1yg2A           WKASHQQVYRELNKMGEQGLVT------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YLGFRVDRQTVEIRGLCPQxxxx
1mzbA           ERGFELVDHNLVLYVRKKK----
2g9wA1          -----------------------
1dpuA           -----------------------
1jhfA1          -----------------------
3bz6A2          -----------------------
2co5A1          -----------------------
1p6rA           -----------------------
1stzA1          -----------------------
1fp2A1          -----------------------
1aoyA           -----------------------
2fnaA1          -----------------------
1z05A1          -----------------------
1yg2A           -----------------------