[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA58884.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hc5A1.bssp"
#ERROR : Can't open dsspfile "1ap5A2.bssp"
#ERROR : Can't open dsspfile "1cojA1.bssp"
#ERROR : Can't open dsspfile "1ap5A1.bssp"
#ERROR : Can't open dsspfile "2axwA1.bssp"
#ERROR : Can't open dsspfile "1sqrA.bssp"

## Summary of PDB Search
:193
    1e-32  13%  2hc5A1 [d.352.1.1] HYPOTHETICAL PROTEIN YVYC A:1 -- 109
    1e-32  47%  1ap5A2 [d.44.1.1] MANGANESE SUPEROXIDE DISMUTASE A:84 -- 198
    1e-27  25%  1cojA1 [a.2.11.1] PROTEIN (SUPEROXIDE DISMUTASE) A:2 -- 90
    5e-27  36%  1ap5A1 [a.2.11.1] MANGANESE SUPEROXIDE DISMUTASE A:1 -- 83
    1e-15  14%  2axwA1 [b.2.3.2] DRAD INVASIN A:1 -- 121
    2e-09  13%  1sqrA  [b.43.3.3] 50S RIBOSOMAL PROTEIN L35AE
:193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
2hc5A1          ----LNIERL--TTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLL-EPSQVHLKFELH
1ap5A2          ----------------------------------------------------------------------
1cojA1          --HKLEPKDHLKPQNLEGISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFADRSKANQLKVEETFNYMG
1ap5A1          --HSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIAQPALKFNGGG
2axwA1          --------------------------------------------------AELHLESRGGSGTQLRDGAT
1sqrA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
2hc5A1          DKLNEYYVKVIEDSTNEKRWLDFYAAMTEFLGLFVDEK--------------------------------
1ap5A2          --------------GGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGNKERGHLQIAACP
1cojA1          VVLHELYFGMLTP---------------------------------------------------------
1ap5A1          HINHSIFWTNLSP---------------------------------------------------------
2axwA1          GRIHTGFHVWMNERQVDGRAE----------RYVVQSKDGRHELRVRTGGDGWSPVKG--EGGKGVSRPG
1sqrA           -----------------------------------------------MRIKG-VVLSYRR-------SKE


                         +         .         .         .         .         *         .:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVAKNLAx
2hc5A1          -----------------------------------------------------
1ap5A2          NQDPLQGTTLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYM-
1cojA1          -----------------------------------------------------
1ap5A1          -----------------------------------------------------
2axwA1          QEEQVFMADGNQDIAPGEY----------------------------------
1sqrA           NQHNNV--MIIKPLDVNSREEAS--KLIGRLVLWKSPSRVHGTKGAVRARF--