[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA59023.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "2h00A1.bssp"
#ERROR : Can't open dsspfile "1aqiA1.bssp"
#ERROR : Can't open dsspfile "1yb2A1.bssp"
#ERROR : Can't open dsspfile "1uirA.bssp"
#ERROR : Can't open dsspfile "1i1nA.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "2b25A1.bssp"
#ERROR : Can't open dsspfile "1suiA1.bssp"
#ERROR : Can't open dsspfile "2f8lA1.bssp"
#ERROR : Can't open dsspfile "1wxwA2.bssp"
#ERROR : Can't open dsspfile "1pjzA.bssp"
#ERROR : Can't open dsspfile "1f38A.bssp"
#ERROR : Can't open dsspfile "1h1dA.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1l9kA.bssp"
#ERROR : Can't open dsspfile "1ufkA.bssp"
#ERROR : Can't open dsspfile "1p91A.bssp"
#ERROR : Can't open dsspfile "1yzhA1.bssp"
#ERROR : Can't open dsspfile "1o9gA.bssp"
#ERROR : Can't open dsspfile "1m6yA2.bssp"
#ERROR : Can't open dsspfile "2b9eA1.bssp"
#ERROR : Can't open dsspfile "1ne2A.bssp"
#ERROR : Can't open dsspfile "2bzgA1.bssp"

## Summary of PDB Search
:212
    8e-60  56%  1eizA  [c.66.1.2] FTSJ
    2e-10   6%  2h00A1 [c.66.1.54] METHYLTRANSFERASE 10 DOMAIN CONTAINING PROTEIN
    8e-10  15%  1aqiA1 [c.66.1.27] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI A:21 --
    3e-07  17%  1yb2A1 [c.66.1.13] HYPOTHETICAL PROTEIN TA0852 A:6 -- 255
    1e-06  13%  1uirA  [c.66.1.17] POLYAMINE AMINOPROPYLTRANSFERASE
    4e-06  25%  1i1nA  [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    6e-06  29%  1ixkA  [c.66.1.38] METHYLTRANSFERASE
    6e-06  21%  2b25A1 [c.66.1.13] HYPOTHETICAL PROTEIN A:6 -- 329
    2e-05  16%  1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
    3e-05   8%  2f8lA1 [c.66.1.45] HYPOTHETICAL PROTEIN LMO1582 A:2 -- 329
    6e-05  19%  1wxwA2 [c.66.1.51] HYPOTHETICAL PROTEIN TTHA1280 A:65 -- 382
    1e-04   8%  1pjzA  [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE
    2e-04  26%  1f38A  [c.66.1.22] PRECORRIN-8W DECARBOXYLASE
    2e-04  24%  1h1dA  [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE
    3e-04  18%  1o54A  [c.66.1.13] SAM-DEPENDENT O-METHYLTRANSFERASE
    3e-04  38%  1l9kA  [c.66.1.25] RNA-DIRECTED RNA POLYMERASE
    3e-04  19%  1ufkA  [c.66.1.39] TT0836 PROTEIN
    4e-04  21%  1p91A  [c.66.1.33] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A
    5e-04  12%  1yzhA1 [c.66.1.53] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE A:8 --
    5e-04  12%  1o9gA  [c.66.1.29] RRNA METHYLTRANSFERASE
    7e-04  16%  1m6yA2 [c.66.1.23] S-ADENOSYL-METHYLTRANSFERASE MRAW A:2 -- 114
    7e-04  38%  2b9eA1 [c.66.1.38] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    8e-04  36%  1ne2A  [c.66.1.32] HYPOTHETICAL PROTEIN TA1320
    9e-04  11%  2bzgA1 [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE A:17 -- 245
:212

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
1eizA           ---------------------------GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQ
2h00A1          ---CTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGAT
1aqiA1          ----------------------------------------------APRGGRVLEPACAHGPFLRAFREA
1yb2A1          -----------------------------KSFIVSDFSPXYFGRVICGPGXDILEVGVGSGNXSSYILYA
1uirA           ------ESKGFGKVLILDKDVQSTERDEYIYHETLVHPAM----LTHPEPKRVLIVGGGEGATLREVLKH
1i1nA           ------------RSHYAKCYMDSPQSIGFQATISAPHMHAYALELLFDEGAKALDVGSGSGILTACFARM
1ixkA           ---REPFSITSTPEFLTGLIYIQEASSXYPPVAL-----------DPKPGEIVADXAAAPGGKTSYLAQL
2b25A1          ------------------------------------------------PGDTVLEAGSGSGGMSLFLSKA
1suiA1          --------------FPREHEAMKELREVTAKHPWNIMTTSADEGQFLSNAKNTMEIGVYTGYSLLATALA
2f8lA1          ----------------------------------------------KKKNVSILDPACGTANLLTTVINQ
1wxwA2          ---------PLLGEVPERQVQEGRVRYLVDLRAAYLDQRENRLYXERFRGERALDVFSYAGGFALHLALG
1pjzA           ----------------------------------------------VVPGARVLVPLCGKSQDMSWLSGQ
1f38A           ----------------------------------------------PGKNDVAVDVGCGTGGVTLELAGR
1h1dA           --------------------------------------------------SLVLELGAYCGYSAVRMARL
1o54A           ------------------------------------------------EGDRIIDTGVGSGAMCAVLARA
1l9kA           ------------------------------SRGSAKLRWFVER-NLVTPEGKVVDLGCGRGGWSYYCGGL
1ufkA           --------------------------------------------RHLRPGDKVLDLGTGSGVLAIAAEKL
1p91A           -------------------------------------------ERLDDKATAVLDIGCGEGYYTHAFADA
1yzhA1          ----------------------------------------------GNDNPIHVEVGSGKGAFVSGXAKQ
1o9gA           ----------SSDLACGVVLHSAPGYPAFPVRLATEIFQRALARLPGDGPVTLWDPCCGSGYLLTVLGLL
1m6yA2          ----------------------------------------------PEDEKIILDCTVGEGGHSRAILEH
2b9eA1          ------------------------------------------------PGSHVIDACAAPGNKTSHLAAL
1ne2A           --------------------------------AAYFLIEIYNDGNI--GGRSVIDAGTGNGILACGSYLL
2bzgA1          ------------LEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGK-SGLRVFFPLCGKAVEXKWFADR


                         .         .         *         .         .         .         .:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
1eizA           IGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMY
2h00A1          LNGWYFLATEVDDMCFNYDLIKVVKVPQKTLL--MDALKEESEIIYDFCMCNPPFFGITEIM-AEGGELE
1aqiA1          HGTGYRFVGVEIDPKALDLPPWAEGADFLLWEPGEAFDLILGNPPYGIVKAV--KDLYKKAFSTWKGKYN
1yb2A1          LNGKGTLTVVER----------------------------------------------------------
1uirA           PTV-EKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLERTEERYDVVIIDLT----DPVGEDNPARLL
1i1nA           VGCTGKVIGIDHIKELVDDSVNNVR---KDDPTLLSSGR------VQLVVGDGRMGYAEEAPYD---AIH
1ixkA           XRNDGVIYAFDV----------------------------------------------------------
2b25A1          VGSQGRVISFEVRKDH----HDLAKKNYKHWRDSWKLSHVEEWPNVDFIHKDISGATFDAVALDMLNP--
1suiA1          IPEDGKILAMDINK--------------------------------------------------------
2f8lA1          LELKGDVDVHASGVDVDDLLISLALVGADLDGLANLLVDPVDVVISDLPVGYYDENAKTFELCREEGHSF
1wxwA2          F---REVVAVDS----------------------------------------------------------
1pjzA           VGAELSEAAVERYFTERGEQPHITSQGDFKVYAAPGIEIWCGDFFALTARDIGHCAAFYDRAAMIALPAD
1f38A           V---RRVYAIDR----NPEAISTTEXNLQRHGL-------------------------------------
1h1dA           LQPGARLLTMEMQQMLNFAGVTILNGASQD--LIPQLKKKYDVDTLDMVFLD------------------
1o54A           VGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGFDVDALFLDVPDP--------------
1l9kA           ----------------------------------------------------------------------
1ufkA           ---GGKALGVDIDP----MVLPQAEANAKRNGVR---------PRFLEGSLEAALPFGPFDLLVANLYAE
1p91A           LPE-ITTFGLDVSKAKRYPQVTFCVASSHRL----PFSDTSXDAIIRIYAPCKAEELAGWVITATPGPRH
1yzhA1          NPD-INYIGIDI----QKSVLSYALDKVLEVGVPNIKLLWVDGSDLTDYFEDGEIDRLYLNFSDPEKRRL
1o9gA           HRRSLRQLAAKNLALLSPAGLTARELERRE----------------------------------------
1m6yA2          CP-GCRIIGIDVDSKLKEFSDRVSLFKVSYREADFLLKTLGIEK-VDGILXDLG--VSTYQLKGENRELE
2b9eA1          LKNQGKIFAFDL----------------------------------------------------------
1ne2A           GAE--SVTAFDIDPDRNCGGVNFXVADVSE----------------------------------------
2bzgA1          ---GHSVVGVEISELGIQEFFTEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDXIWDRGALVAINPG


                         +         .         .         .         .         *         .:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKDxx
1eizA           LVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVAT-------
2h00A1          FVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIGVPKVTYTEFCQGRTMRWALA-----------
1aqiA1          LYGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVF---------------
1yb2A1          ----------------------------------------------------------------------
1uirA           YTVEFYRLVKAHLNPGGVMGMQTGLLRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASD------
1i1nA           VGAAAPVVPQDQLKPGGRLILPVGPAGGNQMLEQY-----------------------------------
1ixkA           ----------------------------------------------------------------------
2b25A1          --HVTLPVFYPHLKHGGVCAVYVVNITQVIELLDGIR---------------------------------
1suiA1          ----------------------------------------------------------------------
2f8lA1          AHFLFIEQGXRYTKPGGYLFFLVPDAXFGTSDFAKVDKFIKKIIKLPETLFKSQARKSILILEKADVD--
1wxwA2          ----------------------------------------------------------------------
1pjzA           MRERYVQHLEALMPQACSGLLITLEYDQALLEGPPFSVPQTWLHRVMSGNWEVTKVGGQDTL--------
1f38A           ----------------------------------------------------------------------
1h1dA           ----------------------------------------------------------------------
1o54A           --WNYIDKCWEALKGGGRFATVCPTTNQVQETLKKLQLPFIRIEV-------------------------
1l9kA           ----------------------------------------------------------------------
1ufkA           LHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPL-----EEAAEGEWVLLAYGR------
1p91A           LXEL------------------------------------------------------------------
1yzhA1          TYKTFLDTFKRILPENGEIHFKTDNRGLFEYSLVSFSQYGXKLNGVWLDLHASDFE--------------
1o9gA           ----------------------------------------------------------------------
1m6yA2          NLKEFLKKAEDLLNPGGRIVVISFHSLEDRIVKETFRNSKKLRILTEKPVRPSEEE--------------
2b9eA1          ----------------------------------------------------------------------
1ne2A           ----------------------------------------------------------------------
2bzgA1          DRKCYADTXFSLLGKKFQYLLCVLPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAF-----------


                         .         .         .         +         .         .         .:280
query           xx
1eizA           --
2h00A1          --
1aqiA1          --
1yb2A1          --
1uirA           --
1i1nA           --
1ixkA           --
2b25A1          --
1suiA1          --
2f8lA1          --
1wxwA2          --
1pjzA           --
1f38A           --
1h1dA           --
1o54A           --
1l9kA           --
1ufkA           --
1p91A           --
1yzhA1          --
1o9gA           --
1m6yA2          --
2b9eA1          --
1ne2A           --
2bzgA1          --