[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA59139.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wj0A.bssp"
#ERROR : Can't open dsspfile "1ul4A.bssp"

## Summary of PDB Search
:372
    2e-12  14%  1wj0A  [g.72.1.1] SQUAMOSA PROMOTER-BINDING PROTEIN-LIKE 12
    1e-04   8%  1ul4A  [g.72.1.1] SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 4
:372

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------------------------------------------------------
1ul4A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxIEYKAKLAGVFVQYIDPWYTSRTCSACGHADKANRKTQSHFQCVSCGYTxxxxxxxxxxxxxxxxxx
1wj0A           ---ICCQVDNCGADLSKVKDYHRHKVCEIHSKATTALVGGIMQRFCQQCSRF------------------
1ul4A           ----LCQVDRCTADMKEAKLYHRHKVCEVHAKASSVFLSGLNQRFCQQCSRF------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxx
1wj0A           ----------------------
1ul4A           ----------------------