[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA59402.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vhnA.bssp"
#ERROR : Can't open dsspfile "1z41A1.bssp"
#ERROR : Can't open dsspfile "1djnA1.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"
#ERROR : Can't open dsspfile "1gt8A2.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "1tzzA1.bssp"
#ERROR : Can't open dsspfile "1to3A.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1f61A.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1dorA.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1mumA.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1xi3A.bssp"
#ERROR : Can't open dsspfile "1hg3A.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "1jpdX1.bssp"
#ERROR : Can't open dsspfile "1m1bA.bssp"
#ERROR : Can't open dsspfile "1vzwA1.bssp"
#ERROR : Can't open dsspfile "1dhpA.bssp"
#ERROR : Can't open dsspfile "1vizA.bssp"
#ERROR : Can't open dsspfile "1ag1O.bssp"
#ERROR : Can't open dsspfile "1w37A.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1dtnA1.bssp"
#ERROR : Can't open dsspfile "1geqA.bssp"
#ERROR : Can't open dsspfile "1qo2A.bssp"
#ERROR : Can't open dsspfile "1piiA1.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1m3uA.bssp"
#ERROR : Can't open dsspfile "1jpmA1.bssp"

## Summary of PDB Search
:337
    2e-62  21%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
    1e-37  15%  1z41A1 [c.1.4.1] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE A:2
    6e-32  14%  1djnA1 [c.1.4.1] TRIMETHYLAMINE DEHYDROGENASE A:1 -- 340
    3e-28  16%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    8e-27  12%  1bwkA  [c.1.4.1] PROTEIN (NADPH DEHYDROGENASE 1)
    1e-24  14%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    4e-24  12%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
    8e-24  22%  1gt8A2 [c.1.4.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:533 -- 844
    2e-23  16%  1ep1A  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    2e-22  12%  1tzzA1 [c.1.11.2] HYPOTHETICAL PROTEIN L1841 A:1146 -- 1392
    3e-21  14%  1to3A  [c.1.10.1] PUTATIVE ALDOLASE YIHT
    4e-21  12%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    6e-20  12%  1f61A  [c.1.12.7] ISOCITRATE LYASE
    7e-19  17%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    3e-18  13%  1dorA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE A
    6e-18  14%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
    2e-15  12%  1mumA  [c.1.12.7] 2-METHYLISOCITRATE LYASE
    5e-15  13%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    4e-14  12%  1xi3A  [c.1.3.1] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    5e-14  14%  1hg3A  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    7e-14   8%  1dqwA  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-12  12%  1jpdX1 [c.1.11.2] L-ALA-D/L-GLU EPIMERASE X:114 -- 321
    3e-11  12%  1m1bA  [c.1.12.7] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    1e-09  21%  1vzwA1 [c.1.2.1] PHOSPHORIBOSYL ISOMERASE A A:2 -- 240
    2e-08  16%  1dhpA  [c.1.10.1] DIHYDRODIPICOLINATE SYNTHASE
    3e-08  25%  1vizA  [c.1.4.1] PCRB PROTEIN HOMOLOG
    6e-08  17%  1ag1O  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    8e-08  11%  1w37A  [c.1.10.1] 2-KETO-3-DEOXY GLUCONATE ALDOLASE
    7e-07  10%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
    9e-07  15%  1dtnA1 [c.1.11.2] MANDELATE RACEMASE A:133 -- 359
    3e-06  15%  1geqA  [c.1.2.4] TRYPTOPHAN SYNTHASE ALPHA-SUBUNIT
    3e-06  15%  1qo2A  [c.1.2.1] ?
    6e-06  12%  1piiA1 [c.1.2.4] N-(5'PHOSPHORIBOSYL)ANTHRANILATE ISOMERASE A:255
    7e-06  28%  1gpwA  [c.1.2.1] HISF PROTEIN
    1e-05   9%  1m3uA  [c.1.12.8] 3-METHYL-2-OXOBUTANOATE HYDROXYMETHYLTRANSFERASE
    8e-05  14%  1jpmA1 [c.1.11.2] L-ALA-D/L-GLU EPIMERASE A:126 -- 359
:337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLFSYDCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYH
1vhnA           --------------------KVGLAPXAGYTDSAFRTLAFEWG-ADFAFSEXVSAKGFLXNSQTEELLPQ
1z41A1          ----------VEASAVNPQGRITDQDLGIWSDEHIEGFAKLT--EQVKEQGSKIGIQLAHAGRKAELEGS
1djnA1          ---------------WDEGDVRNLKAMTDEVHKYGALAGVELWY-GGAHAPNMESRATPRGPSQYASETL
1ps9A1          ---------VSGGIAPDLTGVGMEGGAMLNDASQIPHHRTIT--EAVHQEGGKIALQILHTGRYQAPINR
1bwkA           ----------TEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFEKKSFVWVQLWVLGWAAFPDNLARDGLN
1d3gA           -----SDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKVEHRLRARQQKQAKLT
1znnA1          ----------------------------------------------------------------------
1gt8A2          ----------------------------------------------------------------------
1ep1A           ------------------------PRFGNPTPRVAET------ASGMLNAIGLQNPGLEVIMTEKWLNEN
1tzzA1          ----------------------------------------------------------------------
1to3A           ------------------------VADSVLTDVNAAKILSPYASAVLLDQQFCYRQAVEQNAVAKSCAXI
2a4aA1          ------------------TDHTFLDENGTEDDI--RELCNE-SVKTCPFAAAVCVYPKFVKFINEKIKKP
1f61A           ------------VVGTPKSAEQIQQE--WDTNPRWKDVTRTVALQGSVVEEHTLARRGAEVLWEQLHDLE
1j2wA           ------------------------------------------------YGLCIPPSYVAWVRARYPHAPF
1dorA           ---------NTTFANAKFANPFMNASGVHCMTIEDLEELKASQA-GAYITKSSTLEKREGNPLPRYQKEN
1al7A           -----NIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSS--WATSSVEEVAST
1mumA           ----------------------------------------------------------LHSPGKAFRAAL
1jcjA           ---------------------------------------------PVGNTAAICIYPRFIPIARKTLKEQ
1xi3A           ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1dqwA           ATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKAF
1jpdX1          ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------
1vzwA1          ----------------------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
1vizA           ----------------------------------------------------------------------
1ag1O           ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1efzA           ------------------------IILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDAGGYQVMSL
1dtnA1          ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1qo2A           ----------------------------------------------------------------------
1piiA1          ----------------------------------------------------------------------
1gpwA           ----------------------------------------------------------------------
1m3uA           ----------------------------------------------------------------------
1jpmA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFGACLMAEPELVAECVAAMAQA
1vhnA           PHERNVAVQIFGSEPNELSEAARILSE-KYKWIDLNAGCPVRKVVKEGAGGALLKDLRHFRYIVRELRKS
1z41A1          ATPVEXSAEKVKETVQEFKQAAARAKEAGFDVIEIHAASPLSNHRTDEYGGSPENRYRFLREIIDEVKQV
1djnA1          SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGANPYYNKRTDKYGGSLENRARFWLETLEKVKHA
1ps9A1          FVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSELRTNQRSDQWGGDYRNRMRFAVEVVRAVREG
1bwkA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSLDPHSNTRTDEYGGSIENRARFTLEVVDALVEA
1d3gA           EDGLPLGVNLGKNKTSVDYAEGVRVLGPLADYLVVNVSSPNTA---GLGKAELRRLLTKVLQERDGLRRV
1znnA1          --SIPVMAKVRIGHYVEARVLEALGVDYIDESEVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEG
1gt8A2          ----VIASIMCSYNKNDWMELSRKAEASGADALELNLSCPHGM---GEMGLACGQDPELVRNICRWVRQA
1ep1A           FPELPIIANVAGSEEADYVAVCAKGDAANVKAIELNISCPNVKHG----GQAFGTDPEVAAALVKACKAV
1tzzA1          NPRVFVYAAGGYYGLSMLRGEMRGYLDRGYNVVKMKIGGA---------------PIEEDRMRIEAVLEE
1to3A           VAADPGNGIPVDNVVLDKKINAQAVKRDGAKALKLLVLWRSDED-----AQQRLNXVKEFNELCHSNGLL
2a4aA1          KIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIENTDEGLKEATKLT------QSVKKLL
1f61A           WVAGLKAIYLSGWQVAG---DANLSGHTYPDQSLYPANSVPQVVRRI--NNALQRADQIAKIEGDTSVEN
1j2wA           RLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHL----------GRAKAGDLDYLEAEVRAVREA
1dorA           AQEGPIFFSIAGMSAAENIAMLKKIQESFSGITELNLSCP-----NVPGKPQLAYDFEATEKLLKEVFTF
1al7A           GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLKNFEGIDLG
1mumA           TK--ENPLQIVGTIN---ANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLGIST--LDDVLTDIRRITDV
1jcjA           GTPTVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAA------
1xi3A           ----------TDRRLKPEVESVREALEGGATAIQMRIKNAP-------TREMYEIGKTLRQLTREYDALF
1hg3A           -------FKTYIEATGKLEIAKAAEKVYKETGVTIVVAPQAESVEIPVFAQHIDPIKPGSHTGHVLPEAV
1dqwA           LLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPG----------IVSGLKQAAEEVTKEPRG
1jpdX1          --TVITAQTVVIGTPDQMANSASTLWQAGAKLLKVKLDN-----------------HLISERMVAIRTAV
1m1bA           --PILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTSLHDGRAQPLADIEEFALKIKACKDSQ
1vzwA1          ------------GSPLEAA---LAWQRSGAEWLHLVFGTGDNR------------------ALIAEVAQA
1dhpA           ---------------------------------------------------------------------A
1vizA           ----------------------------------------------------------------------
1ag1O           ---------------------------------------------------------VVVLTQIAAIAKK
1w37A           ----------NRIDKEKLKIHAENLIRKGIDKLFVN----------GTTGLGPSLSPEEKLENLKAVYDV
1efzA           SSLTKQSEEDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSR
1dtnA1          ----QAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYP-----------ALDQDLAVVRS--IRQAVG
1geqA           -------LTAGDPDKQSTLNFLL-ALDEYAGAIELGIPFS-DPIADGKTESHYRAKLREAFWIVKEFRRH
1qo2A           ----------------------------------------------------------------------
1piiA1          ---------------------AKAAYDAGAIYGGLIFVATSPRCVN--------------VEQAQEVMAA
1gpwA           ----------------------------------------------------------------------
1m3uA           ----------------------------------------------------------------------
1jpmA1          ----ETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDD-----------IATDIARIQEIRKRV--G


                         +         .         .         .         .         *         .:210
query           TQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRYDVVRTIKQ
1vhnA           VSGKFSVKTRLGWEKNEVEE----IYRILVEEGVDEVFIHTRTVVQSF--------TGRAEWKALSVLEK
1z41A1          WDGPLFVRVSASDYTDKGLDIADGFAKWXKEQGVDLIDCSSGALV-----HADINVFPGYQVSFAEKIRE
1djnA1          VGSDCAIATRFGVDTVYGPEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSRFYQQGHTIPWVKLVK
1ps9A1          NDFIIIYRLSMLDLDGGTFAETVELAQAIEAAGAT--IINTGIGWHEARIPTIATPVPRGAFWVTRKLKG
1bwkA           ISPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVY
1d3gA           HRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLRDLSTQTIREMYA
1znnA1          ASMLRTKGEPGTGNIVEAVRHMR-------KVNAQIRKVVNMSEDELVAEAKQLGAPVEVLREIKRLGRL
1gt8A2          VQIPFFAKLTPNVTD------IVSIARAAKEGGADGVTATNTVSGLMGLKADSGTAIRPIALRAVTTIAR
1ep1A           SKVPLYVKLSPNVTDIVPIAKAVEGLTMINTLMGVRFDLKTRQPILANITGGSGPAIKPVALKLIHQVAQ
1tzzA1          IGKDAQLAVDANGR--FNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQ
1to3A           SIIEPVVRPPRCGDKFDREQAIIDAAKELGDSGADLYKVEXPLYG---------KGARSDLLTASQRLNG
2a4aA1          TNKILKVIIEVGELKTE--DLIIKTTLAVLNGNADFIKTSTGKVQ-INATPSSVEYIIKAIKEYIKNNPE
1f61A           WLAPIVADGEAGFGGALNVY---ELQKALIAAGVAGSHWEDQ--------------LASEKKCGHLGGKV
1j2wA           VQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGA-----------SLEDVALLVRVAQG
1dorA           FTKPLGVKLPPYFDLVHFDIMAEI----LNQFPLTYVNSVNSIGN--------GLFIDPEAESVVIKPKD
1al7A           LSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEHGAAGIIVSNHGARQLDYVPATIMALEEVVKA
1mumA           CSLPLLVDADIGFG--SSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAV
1jcjA           -NVLLKVIIETGELKDE--ALIRKASEISIKAGADFIKTSTGKVA-VNATPESARIMMEVIRDMGV----
1xi3A           F-VDDRVDVALAVDDGVQLGPEDMPIEVAKEIAPNLIIGASKGADYLGAGSVFPTDARVIGLEGLRKIVE
1hg3A           KEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTMVVAVEPPELIGTGIPVSKAKPEVITNTVELVKK
1dqwA           LLMLAELSCKGSLSTGEYTKG--------------TVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTP
1jpdX1          PDATLIVDANESWRAEG----LAARCQLLADLGVAMLEQPL----------------PAQDDAALENFIH
1m1bA           TDPDFCIVARVEAFIAGWGLDEALKR--------------AEAYRNAGADAILMHSKKADPSDIEAFMKA
1vzwA1          MDIKVELS--GGIRDDDTLAACTRVNLGTAALETPEWVAKVIAEHLRGRGTRDGGDLYETNLELLKNVCA
1dhpA           IVTPMDEKGNVC------RASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADV------VMMTLDL
1vizA           -------------------------------------------------------------IEAVKKTKA
1ag1O           LKKADWAKVVIAYEPVWA--------------------IGTGKVA----TPQQAQEAHALIRSWVSSKIG
1w37A           TNKIIFQVGGLNLD--DAIRLAKLS----KDFDIVGIASY--------APYYYPRMSEKHLVKYFKTLCE
1efzA           KEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAV----------GEGQDEMFRVLDFSVP
1dtnA1          DDFGIMVDYNQSLDVPAAIKRSQAL----QQEGV---------TWIEEPTLQHD-------YEGHQRIQS
1geqA           SSTPIVLMTYYNPIYRAGVRN---FLAEAKASGVDGILVVLKVIDDMTVYLVSLYEIPKTAYDLLRRAKR
1qo2A           ------------------------------------------------------IENSGENLPVLEKLSE
1piiA1          APLQYVGVFRNHDI--------ADVVDKAKVLSLAAVQLHG-----------------NEEQLYIDTLRE
1gpwA           ------------------------------------------------------VEKRKTMLELVEKVAE
1m3uA           ---PTTISLLQKYKQEKKRFATYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTVADIAYHTAAVRR
1jpmA1          SAVKLRLDANQGWRPKEAVTAIRKME----DAGLGIELVEQP--------------VHKDDLAGLKKVTD


                         .         .         .         +         .         .         .:280
query           DFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYV
1vhnA           RIP---TFVSGDIFTPEDAKRALEECDGLLVARGAIGRPWIFKQIKDFLRSGKYSEPSREEILRTFERHL
1z41A1          QAD-XATGAVGXITDGSXAEEILQNADLIFIGRELLRDPFFARTAAKQLNTE------------------
1djnA1          QVSKKPVLGVGRYTDPEKMIEIVTKADIIGCARPSIADPFLPQKVEQGR---------------------
1ps9A1          HV-SLPLVTTNRINDPQVADDILSRADMVSMARPFLADAELLSKAQSGR---------------------
1bwkA           SIWKGPVIRAGNFALHPEVVREEVKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYPTY
1d3gA           LTGRVPIIGVGGVSSGQDALEKIRAASLVQLYTALFWGPPVVGKVKREL---------------------
1znnA1          PVV---NFAAGGVTTPADAALMMHLADGVFVGSGIFKSENPEKYARAI----------VEATTHYEDYEL
1gt8A2          ALPGFPILATGGIDSAESGLQFLHSASVLQVCSAVQNQDFTVIQ--------------------------
1ep1A           DV-DIPIIGMGGVANAQDVLEMYMAASAVAVGTANFADPFVCPKIIDKL---------------------
1tzzA1          DARN-----------LLRYGGMRPDRDWLQFDCALSYGLCEYQRTLE--VLKTHGWSPSHGGHQMSLNIA
1to3A           HINXPWVILSSGVDEKLFPRAVRVAXSGFLAGRAVWSSVIGLPDTE------------------------
2a4aA1          KNNKIGLKVSGGISDLNTASHYILLRRFLSDNFRIG-SSSLVIKLRK-----------------------
1f61A           LIP-----TQQHIRTLTSARLAADVAPTVVIARTDAEAATLITSDVDERDQPFITGERTRE---------
1j2wA           RAQ---VKAAGGIRDRETALRMLKAASRLGTSSGV-----------------------------------
1dorA           GFGGIGYIKPTALANVRAFYTRLKPATMLQIGTALKEGPAIFDRIIKELIMNQKGYQSIADFH-------
1al7A           AQGRIPVFLDGGVRRGTDVFKALALAAGVFIGRPVVFSLAAEGEAGVKKVLQ--------MMRDEFELTM
1mumA           DAKTDPDFVIMARTDALAVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFG
1jcjA           -EKTVGFLPAGGVRTAEDAQKYLAIDELFGADWA---DARHYR---------------------------
1xi3A           SVK-IPVVAIGGINKDNAREVLKTGVDGIAVISAVMGAEDVRKATEE-----------------------
1hg3A           VNPEVKVLCGAGISTGEDVKKAIELTVGVLLASGVTKAKDPEKAIWD-----------------------
1dqwA           GVG-LDDKGDALGQQYRTVDDVVSTSDIIIVGRGLFAKGRDAKVEGE-----------------------
1jpdX1          PLP---ICADESCHTRSNLKALKGRYEMVNI---------------------------------------
1m1bA           WNNQGPVVIVPTKYYKTPTDHFRDMVSMVIWANHNLRASVSAIQ--------------------------
1vzwA1          ATD-RPVVASGGVSSLDDLRAIAGLVEGAIVGKALYAKAFTLEEA-------------------------
1dhpA           ADGRIPVIAGTGANATAEAISLTQRFVGCLTVTPYYNRPSQEGLYQ------------------------
1vizA           VLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDF-------------------------------
1ag1O           AAGELRILYGGSVNG-KNARTLYQQRNGFLVGGASLKPEFV-----------------------------
1w37A           VSPPVYLYNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNP-NMLVYSGSDMLIATVASTG
1efzA           MLPDDKPHYLMGVGKPDDIVGAVERIDMFDCVLPTRSGR-------------------------------
1dtnA1          KLN-VPVQMGENWLGPEEMFKALSICRLAMP--------------DAMKIGGVTGWIRASALAQQFIPMS
1geqA           -ICRNKVAVGFGVSKREHVVSLLKEANGVVVGSALVKIIGEKGR--------------------------
1qo2A           FAEHIQI--GGGIRSLDYAEKLRKLYRRQIVSSKVLEDPSFLKSL-REIDVE------------------
1piiA1          ALPAHVAIWKALSVGETLPAREFQHVDKYVLDNGQGGSGQ------------------------------
1gpwA           QID-IPFTVGGGIHDFETASELILRADKVSINTAAVENPSLITQIAQTFGSQ------------------
1m3uA           GAPNCLLLADLPFMAYATPEQAFENANMVKIEGGEWLVET------------------------------
1jpmA1          ATD-TPIMADESVFTPRQAFEVLQTADLINIKLM------------------------------------


                         .         *         .         .         .         .         +:350
query           AEQLVQGVYLNHMTRHILGLFQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPx
1vhnA           ELLIKTKKAVVEXRKFLAGYTKDLKGARRFREKVXK-IEEVQILKEXFYNFIKEV--
1z41A1          ---------------------------------------------------------
1djnA1          ---------------------------------------------------------
1ps9A1          ---------------------------------------------------------
1bwkA           EEALKLGWDKS----------------------------------------------
1d3gA           ---------------------------------------------------------
1znnA1          IAHLSKGL-------------------------------------------------
1gt8A2          ---------------------------------------------------------
1ep1A           ---------------------------------------------------------
1tzzA1          AGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPD---LPGIGFEGKSDLYKEMK-
1to3A           ---------------------------------------------------------
2a4aA1          ---------------------------------------------------------
1f61A           ---------------------------------------------------------
1j2wA           ---------------------------------------------------------
1dorA           ---------------------------------------------------------
1al7A           ALSGCR--SLKEISRSHI---------------------------------------
1mumA           ATPLFT--TDELRSAHVAMALYPLSAFRAMNRAAEHVYNV-----------------
1jcjA           ---------------------------------------------------------
1xi3A           ---------------------------------------------------------
1hg3A           ---------------------------------------------------------
1dqwA           ---------------------------------------------------------
1jpdX1          ---------------------------------------------------------
1m1bA           ---------------------------------------------------------
1vzwA1          ---------------------------------------------------------
1dhpA           ---------------------------------------------------------
1vizA           ---------------------------------------------------------
1ag1O           ---------------------------------------------------------
1w37A           LDGNVANYLPEVTVTIKKLAMERKDEALKLQFLHVIEASRIFGSLSSNYVLTKYF--
1efzA           ---------------------------------------------------------
1dtnA1          SAHLLAATPTAHWLQRLDSVIEPTLTFEGGNAVIPD---LPGVGIIWREKEIGK---
1geqA           ---------------------------------------------------------
1qo2A           ---------------------------------------------------------
1piiA1          ---------------------------------------------------------
1gpwA           ---------------------------------------------------------
1m3uA           ---------------------------------------------------------
1jpmA1          ---------------------------------------------------------