[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA59494.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qo2A.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1vzwA1.bssp"
#ERROR : Can't open dsspfile "1t6jA.bssp"
#ERROR : Can't open dsspfile "1z41A1.bssp"
#ERROR : Can't open dsspfile "1a50A.bssp"
#ERROR : Can't open dsspfile "1mumA.bssp"
#ERROR : Can't open dsspfile "1to3A.bssp"
#ERROR : Can't open dsspfile "1djnA1.bssp"
#ERROR : Can't open dsspfile "1g8mA2.bssp"
#ERROR : Can't open dsspfile "1h1yA.bssp"
#ERROR : Can't open dsspfile "1jcmP.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"
#ERROR : Can't open dsspfile "1q7mA1.bssp"
#ERROR : Can't open dsspfile "2ocdA1.bssp"
#ERROR : Can't open dsspfile "1tygA.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1geqA.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "1y0eA.bssp"
#ERROR : Can't open dsspfile "2ap9A1.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "2aqwA1.bssp"
#ERROR : Can't open dsspfile "1hg3A.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1ytdA1.bssp"
#ERROR : Can't open dsspfile "1xi3A.bssp"
#ERROR : Can't open dsspfile "1m1bA.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1z41A1.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"

## Summary of PDB Search
:249
    2e-70  29%  1qo2A  [c.1.2.1] ?
    1e-55  25%  1gpwA  [c.1.2.1] HISF PROTEIN
    2e-47  39%  1vzwA1 [c.1.2.1] PHOSPHORIBOSYL ISOMERASE A A:2 -- 240
    8e-23  12%  1t6jA  [a.127.1.2] PHENYLALANINE AMMONIA-LYASE
    8e-16  17%  1z41A1 [c.1.4.1] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE A:2
    2e-13  15%  1a50A  [c.1.2.4] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-13  11%  1mumA  [c.1.12.7] 2-METHYLISOCITRATE LYASE
    5e-12  15%  1to3A  [c.1.10.1] PUTATIVE ALDOLASE YIHT
    8e-12  11%  1djnA1 [c.1.4.1] TRIMETHYLAMINE DEHYDROGENASE A:1 -- 340
    8e-11  13%  1g8mA2 [c.97.1.4] AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE A:201 --
    1e-09  10%  1h1yA  [c.1.2.2] D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE
    7e-09  14%  1jcmP  [c.1.2.4] INDOLE-3-GLYCEROL-PHOSPHATE SYNTHASE
    7e-09  11%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    2e-08  15%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
    2e-08  18%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
    6e-08  10%  1q7mA1 [c.1.21.2] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE A:301 --
    9e-08  11%  2ocdA1 [c.88.1.1] L-ASPARAGINASE I A:2 -- 337
    3e-07  25%  1tygA  [c.1.31.1] THIAZOLE BIOSYNTHESIS PROTEIN THIG
    6e-07  14%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
    9e-07  14%  1geqA  [c.1.2.4] TRYPTOPHAN SYNTHASE ALPHA-SUBUNIT
    2e-06  30%  1a53A  [c.1.2.4] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    2e-06  18%  1y0eA  [c.1.2.5] PUTATIVE N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-
    2e-06  17%  2ap9A1 [c.73.1.2] ACETYLGLUTAMATE KINASE A:6 -- 296
    3e-06  11%  1bwkA  [c.1.4.1] PROTEIN (NADPH DEHYDROGENASE 1)
    4e-06  15%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    6e-06  15%  2aqwA1 [c.1.2.3] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE A:2
    1e-05  14%  1hg3A  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    2e-05  23%  1ep1A  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    2e-05  13%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
    2e-04  26%  1ytdA1 [c.1.17.1] NICOTINATE PHOSPHORIBOSYLTRANSFERASE FROM A:120
    3e-04  12%  1xi3A  [c.1.3.1] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    5e-04  12%  1m1bA  [c.1.12.7] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    5e-04  16%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    4e-06  17%  1z41A1 [c.1.4.1] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE A:2(query 150->227)
    3e-05  12%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE(query 30->133)
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
1qo2A           -LVVPAIDLFRGKVARXIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS
1gpwA           --IIACLNVKDGRVVK---GTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKVA
1vzwA1          LELLPAVDVRDGQAVR---------ETSYGSPLEAALAWQRSGAEWLHLVDLDAAF-GTGDNRALIAEVA
1t6jA           ---------------------------------------------------------TQVTQVDIVEKXL
1z41A1          -------------FVRVSASDYTDKGLDIADHIGFAKWXKEQGVDLIDCSSGADINVFPGYQVSFAEKIR
1a50A           -----------------------------EQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRA
1mumA           --------LTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRIT
1to3A           -----------------------------TDFKVNAAKILSPYASAVLLYRQAVEQNAVAKSCAXIVAAD
1djnA1          --MTDEVHKYGALAGVEYGGAHAPNMESRATPRGPQYASEFETLSYCKEMDLSDIAQVQQFYVDAAKRSR
1g8mA2          AEVSNAIDQYVTGTIGEDEDLVKWQAXFEEVPAQLTEAEKKQWIAKLTAVSLSSDA--FFPFRDNVDRAK
1h1yA           -----------------------------ANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSL
1jcmP           -----------------------------DFDPARIAAIYKHYASAISVLTDEKYFQGSF---NFLPIVS
1ps9A1          -------DLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSALQAPIN
1znnA1          ------------------------------------------------------------ADPTVIEEVM
1vhnA           ----------------------------------------------------------------------
1q7mA1          ----HFVVIGERINPAGRKKWAEMQKGNEEIVIKEAKTQVEKGA---EVLDVNFGIESQIDVRYVEKIVQ
2ocdA1          ----------------------------------------------------------------------
1tygA           ----------------------------------------------------------------------
1al7A           ----IDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEV
1geqA           GILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYEIPKTAYDLLRRAK
1a53A           ----------------------------------------------------------------------
1y0eA           ----------------------------------------------------------------------
2ap9A1          ----------------------------------------------------------------------
1bwkA           ---------------------------------------------------IAAGADGVEINSANGYLLN
1jcjA           -LVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVI
2aqwA1          ----------------------------------------------------------------------
1hg3A           ------------------------------NPDYVAVEPPELIGTGI------PVSKAKPEVITNTVELV
1ep1A           -----------------------------TDIVPIAKAVEAAGADGLTMINTLMGLSGPAIKPVALKLIH
1efzA           -----AFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVG-EGQDEMFRVLDFSV
1ytdA1          -----------------------------MDEKFAAIKIAEMF-DKVDYIRLDTPSSRRGNFEALIREVR
1xi3A           ----------------------------------------------------------------------
1m1bA           ----------DPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILM---HSKKADPSDIEAFMKAWN
1j2wA           ------------------------------------------------FLKTSTGFGPRGASLEDVALLV
1z41A1          ----------------------------------------------------------------------
1vhnA           -----------------------------NEVEEIYRILVEEGVDEVFIHTRTVVQSFTRAEWKALSVLE


                         .         .         *         .         .         .         .:140
query           QALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLEFPGHILLGLDAREGKIAING
1qo2A           EF--AEHIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLK-SLREIDVEPVFSLDTRGGRVAFKG
1gpwA           EQI-DIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQVVVAIDAKEFMVFTYS
1vzwA1          QAM-DIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRG
1t6jA           AAPTDSTLELDGYSLNLGDVVSAARKGRPVRKDSDEIRSKIDKSVEFLRSQTEDAILQKALLECGVLPSS
1z41A1          EQADXATG-AVGXITDGSXAEEILQNGADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERG------
1a50A           FAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVELRHNIAP
1mumA           DVCS-LPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKIVSKEEMVDRIRAAVDAKTDPDF
1to3A           DFIPNGIPVDNVVLDKKINAQAVKRDGAKALKLLVLWRSDEDAQQRLNELCHSNGLLSIIEPVVRPPRCG
1djnA1          DAGFDI-VYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWLETLEKVKHASDCAIATRFGVDTVYG
1g8mA2          RIGVQFIVAPSGSAADEVVIEACNELGITLIHTNL-----------------------------------
1h1yA           RKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGM--------RPGVSLR
1jcmP           QIAPQP-ILCKDFIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTE----------
1ps9A1          RFVPHLSHEEILQLIDNRCAQLAREAGYDGVEVMGSEGYLINEFLRNRMRFAVEVVRAVRERVGNMLDLV
1znnA1          NAV-SIPVMAKVRIGHYVEARVLEALGVDYIDESEVLTPADEEFHIDKRQFTVPFVCGCRIAEGASMLRT
1vhnA           ----------------------------------------------------------------------
1q7mA1          TLPYVSNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELKINLLKKYGGTLIVLL----MGKDVPK
2ocdA1          ---------------------------------PPLLEAGINIELSTNVKVDEKPSGEFKVNPITPQPIG
1tygA           ----------------------------------------------------------------------
1al7A           VKAGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVLQMM--RDEFELTMALSG
1geqA           RICRNKVA-VGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEF-------------------
1a53A           ----------------------------------------------------------------------
1y0eA           ----------------------------------------------------------------------
2ap9A1          ----------GGGPQITAXLR---RLGIEGDFKGGFRVTTPEVLDVARXVLFGQVGRELVNLINAHGPYA
1bwkA           QFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMS--GGAETGIVAQYAY
1jcjA           RDMKTVGFLPAGGVRTAEDAQKYLAIADELFGADW-----------------------------------
2aqwA1          ---------------------------------GTNXLKDICFDYEKNKYYSAYVLIKTTNKDSFIFQNE
1hg3A           KKVPEVKVLCGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAI-----------------------
1ep1A           QVAQDVDIPIMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLP------------------
1efzA           PMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSEC
1ytdA1          WELSDIKIMVSGGL-DENTVKKLREAGAEAFGVGTSISSAKDFAMD------------------------
1xi3A           ---------ITDRRLKPESVREALEGGATAIQMRIKTREMYEIGKTLRQLTREYALFFVDDRVDVALAVD
1m1bA           NQGPVV---IVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTK--------------------
1j2wA           RVAQGRAVKAAGGIRDRETALRMLKAGASRLGTSSGVALV------------------------------
1z41A1          ----------------------------------------------------------------------
1vhnA           KRIP---TFVSGDIFTPEDAKRALESGCDGLLVARGAIGRPWIFKQIKDFLRSGKYSEPSREE-------


                         +         .         .         .         .         *         .:210
query           WSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNIEATSELAKAINIPVIASGGVSSLTEIEALC
1qo2A           WLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGGISSENSLKTAQ
1gpwA           GKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKM---EHFL
1vzwA1          WTR-DGGDLYETLDRLNKEGCARYVVTDI-------GPNLELLKNVCAATDRPVVASGGVSSLDDLRAIA
1t6jA           FDSFRLGGLENSLPLEVVRGAXTIRVNSLTRGHSAVRLVVEALTNFLNHGITPIVPLRGTISXDLSPLSA
1z41A1          ----------------------------------------------------------------------
1a50A           IFICPPNADDDLLRQVASYG--RGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAV
1mumA           VIMARTDALAVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTTD
1to3A           DKFDREQAIIDAAKELGDSGADLYKVEXPLYGKGARSDLLTASQRLNGHINPWVILSSGVDEKLFPRAVR
1djnA1          PGQIEAEVDGQKFVEMADSLVDMWGEDAGPSRFYQQGHTIPWVKLVKQVSKKPVLGVGRYTDPEKMIEIV
1g8mA2          ----------------------------------------------------------------------
1h1yA           PGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAA
1jcmP           ------VSNEEEQERAIALGAKVVGINNRDLCDLSIDLNRTRELAPKLGHNVTVISESGINT----YAQV
1ps9A1          EDGGTFAETVELAQAIEAAGATIINTGIGWHEARIRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDI-
1znnA1          KGEPGTGNIVEAVRHMRKVNAQIRKVVNMSEDELVAEAKVEVLREIKRLGPVVNFAAGGVTTPADAALMM
1vhnA           -------EVEEIYRILVEEGVDEVFIHTRTVVQSFTGAEWKALSVLEK--RIPTFVSGDIFTPEDAKRAL
1q7mA1          SFEERKEYFEKALKILERHDFDRVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVGLSNLSFGLPDR
2ocdA1          VITXYPGISHEVIRNTLLQPVNAXILLTFGVGNAPQNPELLAQLKAASERGVIVVNLTQCLAGKVNXGGC
1tygA           -----------LARKLEELGVHAIM-PGASPIGSGQGINPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAM
1al7A           CRSLKEISRSHIAADWD-----------------------------------------------------
1geqA           ----------------------------------------------------------------------
1a53A           ------------------------------RDLETLEINKENQRKLISMINVVKVAESGISERNEIEELR
1y0eA           ---------VEEAKNAARLGFDYIGYTSYTQGQLLYQNDFQFLKDVLQSVDAKVIAEGNVIT---PDXYK
2ap9A1          VGITGED--AQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAXLDLVAAGRIPVVSTLAPDADGVV----
1bwkA           VAGELEKRAKA-GKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVRE-
1jcjA           ----------------------------------------------------------------------
2aqwA1          LSINDKQAYIVXADETQKXATELKIEQNNEFIGFVVGSAFEEXKIIRNKFPDSYILSPGIGAQNKTLKNG
1hg3A           ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
1efzA           HCAVCQK---------------------------------------------------------------
1ytdA1          ----------------------------------------------------------------------
1xi3A           ADGVQLGPEDMPIEVAKEIAPNLIIGASVYFPTDARVIGLEGLRKIVESVKIPVVAIGGINKDNAREVLK
1m1bA           ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1z41A1          ---------IGFAKWXKEQGVDLIDCSSGALVHADPGYQVSFAEKIREQADXATGAVGXITDGSXAEEI-
1vhnA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QHEQDGIGGAIIGRALYEEKIQLAEALAIAKRLSGExxx
1qo2A           KVHTETNGGVIVGRAFLEGILTVEVXKRYAR--------
1gpwA           EAFLAGADAALAASVFHFREIDVREL-------------
1vzwA1          GLVPAGVEGAIVGKALYAKAFTLEEALE-----------
1t6jA           AISGHPDSKVHVVHEGKEKILYAREAXALF---------
1z41A1          ---------------------------------------
1a50A           ---RAGAAGAISGSAIVKIIEKNLASPQMLAELRS----
1mumA           ELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGT---
1to3A           VAXEAGASGFLAGRAVWSSVIGLPDTEL-----------
1djnA1          --TKGYADIIGCARPSIADPFLPQKVEQ-----------
1g8mA2          ---------------------------------------
1h1yA           SAGANCI---VAGSSIFGAAEPGEVISALRKSV------
1jcmP           RELSHFANGFLIGSALMAHDDLHAAVRRVLLGE------
1ps9A1          -LSRGDADMVSMARPFL----------------------
1znnA1          HL---GADGVFVGSGIFKSENPEKYARAIVEAT------
1vhnA           EES--GCDGLLVARGAIGRPWIFKQI-------------
1q7mA1          SYYNTAFLVLGI---------------------------
2ocdA1          ---ALADAGVISGYDXTPEAALAKLHYLLSQNLSYE---
1tygA           EL---GADGVLLNTAVSDDPVKMARAMKLA---------
1al7A           ---------------------------------------
1geqA           ---------------------------------------
1a53A           KL---GVNAFLIGSSLMRNPEKIKEFI------------
1y0eA           RVXDLGVHCSVVGGAI-----------------------
2ap9A1          ---------------------------------------
1bwkA           -EVKDKRTLIGYGRFFISNPDLVDRL-------------
1jcjA           ---------------------------------------
2aqwA1          YNKDYEKLLINVGRAITKSPDPKKSSESYYNQI------
1hg3A           ---------------------------------------
1ep1A           ---------------------------------------
1efzA           ---------------------------------------
1ytdA1          ---------------------------------------
1xi3A           TG----VDGIAVISAVMGAEDVRKATEELRKIV------
1m1bA           ---------------------------------------
1j2wA           ---------------------------------------
1z41A1          -LQNGRADLIFIGRELL----------------------
1vhnA           ---------------------------------------