[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for noce0:ABA59517.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bmfD3.bssp"
#ERROR : Can't open dsspfile "1ir6A.bssp"
#ERROR : Can't open dsspfile "1bmfA1.bssp"
#ERROR : Can't open dsspfile "1vprA1.bssp"
#ERROR : Can't open dsspfile "1iw7D.bssp"
#ERROR : Can't open dsspfile "1yvuA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2csuA2.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1g4uS1.bssp"
#ERROR : Can't open dsspfile "1bmfA2.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"

## Summary of PDB Search
:515
    9e-78  26%  1bmfD3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE D:82 -- 357
    9e-70  13%  1ir6A  [c.107.1.2] EXONUCLEASE RECJ
    9e-38  46%  1bmfA1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE A:380 -- 510
    3e-34  10%  1vprA1 [b.60.1.7] LUCIFERASE A:868 -- 1218
    3e-33  16%  1iw7D  [e.29.1.2] RNA POLYMERASE BETA SUBUNIT
    2e-27  12%  1yvuA1 [b.34.14.1] HYPOTHETICAL PROTEIN AQ_1447 A:4 -- 314
    9e-24  18%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    2e-19   8%  2csuA2 [c.23.4.1] 457AA LONG HYPOTHETICAL PROTEIN A:130 -- 290
    1e-17  65%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    7e-15   9%  1g4uS1 [a.24.11.1] PROTEIN TYROSINE PHOSPHATASE SPTP S:167 -- 296
    2e-14  45%  1bmfA2 [b.49.1.1] BOVINE MITOCHONDRIAL F1-ATPASE A:24 -- 94
    4e-04   9%  1bzyA  [c.61.1.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
:515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
1bmfD3          ----------------------------------------------------------------------
1ir6A           ----------------------------------------------------------------------
1bmfA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1iw7D           --------SKEYKLPKEARLLVKDGDYVEAGQPLTRPHQLLEAKGPEAVEVEEIQKVYRAQGVKLHDKHI
1yvuA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2csuA2          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1g4uS1          ----------------------------------------------------------------------
1bmfA2          -------------------------DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEP
1bzyA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT
1bmfD3          --------------------------IRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVE
1ir6A           ---------------------------------AILVRGLAALGADVHPFIPHRLEEYGVLMERVPEHLE
1bmfA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1iw7D           EIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALS--TKSWLS
1yvuA1          ----------------------------------------------------------------------
1pv4A3          ------------------------------------------------------------FENLTPLANS
2csuA2          ----------------------------------------------------------TFITVAKKGNVA
1bmfA3          --------------------------VDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIP
1g4uS1          ----------------------------------------------------------------------
1bmfA2          DNVGVVVFGNDKLIKEGDIVKRTGAI--------------------------------------------
1bzyA           ------------------------DLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVL--KGGYKF


                         +         .         .         .         .         *         .:210
query           RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQKASSVAGV
1bmfD3          MSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAGGYSVFAGVGERTREGNDL
1ir6A           ASDLFLTVDCGITNHAELRELLENGVEVIVTDHHTPGKTPPPGLVVHPALTPDLKEKPTGAGVAFLLLAL
1bmfA1          ----------------------------------------------------------------------
1vprA1          ----------------VPKTNPLHGRWITVSGGQAAFIKEAIKSGMLGAAEANKIVADTDHHQTGGXYLR
1iw7D           AASFQNTTHVLTEAIAGKKDELIGLKENVILGRLTGSDFVRFTQVVDQK---------------------
1yvuA1          ----------------------------------------------------------------------
1pv4A3          RLRXGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLIAQSIAYNHPDCVLXVLLIDERP------
2csuA2          F--ISQSGALGAGIVYKTIKEDIGFSKFISVGNXADVDFAELXEYLADT--EEDKAIALYIEGVRNGKKF
1bmfA3          RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIDTIINQKRFNDGTYCIYVAIGQKRSTVAQL
1g4uS1          ----------------------------------------------------------------------
1bmfA2          ----------------------------------------------------------------------
1bzyA           FADLLDYIKALNRNSDRSMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTL


                         .         .         .         +         .         .         .:280
query           VRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLR
1bmfD3          YHEMIESGATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDEGQDVLLFIDNIFRFTQAGSEVSALLG
1ir6A           HERLGLPPPLEYADAAVGTIADVAPLWGWNRAEGLARIPASSWVGLRLLAEAVGYTGKAVEVAFRIAPRI
1bmfA1          ----------------------------------------------------------------------
1vprA1          INQFGDVCTVDASV------------AKFARAKRTWKSGHYFYEPLVSGGNLLGVWVLPEEYRKIGFFWE
1iw7D           ----------------------------------------------------------------------
1yvuA1          ----------------------------------------------------------------------
1pv4A3          -EEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVVLTG
2csuA2          XEVAKRVTKKKPIIALGSWKIYEAAFKQSGVLVANTIDEXLS----------------------------
1bmfA3          VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1g4uS1          ----------------------------------------------------------------------
1bmfA2          ----------------------------------------------------------------------
1bzyA           LSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKF-----------------------------


                         .         *         .         .         .         .         +:350
query           RPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISI
1bmfD3          RIPSAVGYQPTLATDMGTMQERIT---------------TTKKGSITSVQAIYVPADDLTDPAPATTFAH
1ir6A           NAASRLGEAEALRLLLTDDAAEAQALVGELHRLNARRQTLEEAMLRKLLPQADPEAKAIVLLGHPGVMGI
1bmfA1          ----------------------------------------------------------------------
1vprA1          XESGCFRIERRAFPVGPYTFXRQA---------------TEVGGKISFVFYVKVSNDPESDPIPLQSRDY
1iw7D           ----------------------------------------------------------------------
1yvuA1          ----------------------------------------------------------------------
1pv4A3          GVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTG-------------------SKXDEVIYEEFKGT
2csuA2          ----------------------------------------------------------------------
1bmfA3          RPPGREAYPGDVFYLHSRLLERA----AKMNDAFGGGSLTALP-------VIETQAGDVSAYIPTNVISI
1g4uS1          ----------------------------------------------------------------------
1bmfA2          ----------------------------------------------------------------------
1bzyA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
1bmfD3          LDATTVLSRAIAELGIYPAVDPLDSTSRI-----------------------------------------
1ir6A           VASRILEATLRPVFLVAQGKGTVRSLAPIEALRSAEDLLLRYGGHKEAAGFAMDEALFPAFKARVEAYAA
1bmfA1          ----------------------------------TRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQ
1vprA1          TALAGRDNANLGKPYPTLAKDLDYPKKR------------------------------------------
1iw7D           ----------------------------------------------------------------------
1yvuA1          ------ALLNLYRIEYRPK-DTTFTVFKPTHEIQKEKLNKVRVFLQTGLPTFRREDEFWCAGKVEKDTLY
1pv4A3          GNXELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKXWILRKIIHPXGEIDAXEFLINKLTKTND
2csuA2          ----------------------------------------------------------------------
1bmfA3          TDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQ------------------------------------
1g4uS1          ------PLLDIALKGLKRTLPQLEQMDG---NSLRENFQEMASGNGPLRSLMTNLQNLNKIPEALNDYVT
1bmfA2          ----------------------------------------------------------------------
1bzyA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITK
1bmfD3          ----------------------------------------------------------------------
1ir6A           RFPDPVREVALL----------------------------------------------------------
1bmfA1          QLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRT
1vprA1          ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
1yvuA1          LTLSNGEI--VELKRVGEEEFRGFQNERECQELFRDFLTKTKVKDKFISDFYKKFRDKITVQGKNRKIAL
1pv4A3          DFFE------------------------------------------------------------------
2csuA2          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1g4uS1          TLTNIQVGVARFSQWG-----TCGGEVERWVDKASTHELTQAVKKIHVIAKELKNVTAELEKIE------
1bmfA2          ----------------------------------------------------------------------
1bzyA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TGDYSDEIAAELRAAIENFKTTNTW
1bmfD3          -------------------------
1ir6A           -------------------------
1bmfA1          DGKISEESDAKLKEIVTNFLAG---
1vprA1          -------------------------
1iw7D           -------------------------
1yvuA1          IPEVNEKVLKSEEGYFLLHLDLKFR
1pv4A3          -------------------------
2csuA2          -------------------------
1bmfA3          -------------------------
1g4uS1          -------------------------
1bmfA2          -------------------------
1bzyA           -------------------------