[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL62507.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cvgD.bssp"
#ERROR : Can't open dsspfile "3cvgA.bssp"
#ERROR : Can't open dsspfile "3cvgC.bssp"

## Summary of PDB Search
:313
    4e-09  29%  3cvgD  [x.x.x] PUTATIVE METAL BINDING PROTEIN
    4e-09  29%  3cvgA  [x.x.x] PUTATIVE METAL BINDING PROTEIN
    5e-07  30%  3cvgC  [x.x.x] PUTATIVE METAL BINDING PROTEIN
:313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGLLDVLIPD
3cvgD           ------------------------------------------------------------SGLVKELADA
3cvgA           ------------------------------------------------------------SGLVKELADA
3cvgC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLENGTLKCRDVIAYNFFIIVGPR
3cvgD           FIKSKVDSGF--KVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKHGISESPSYYAFRDHFLIGPP
3cvgA           FIKSKVDSGF--KVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKHGISESPSYYAFRDHFLIGPP
3cvgC           ------------------------------------ITYSPVAERISIKHGISESPSYYAFRDHFLIGPP


                         +         .         .         .         .         *         .:210
query           DDPAGAKSLTATEAFRRIAEAKAPFVSRGDRSGTHLMELSLWRRAIGREPDPKNDTWYISAGAGMGQTLL
3cvgD           SNPAKLSGDSDIADFSKHDAAEARFLSRYDKSATNIKEAELW-LSIGQVPATAYSTWYHQYITFPIQALT
3cvgA           SNPAKLSGDSDIADFSKHDAAEARFLSRYDKSATNIKEAELW-LSIGQVPATAYSTWYHQYITFPIQALT
3cvgC           SNPAKLSGDSDIADFSKHDAAEAGFLSRYDKSATNIKEAELW-LSIGQVPATAYSTWYHQYITFPIQALT


                         .         .         .         +         .         .         .:280
query           LANEKSAYTLSDTGTWLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cvgD           AAILLREYTITDYGTYL-----------------------------------------------------
3cvgA           AAILLREYTITDYGTYL-----------------------------------------------------
3cvgC           AAILLREYTITDYGTYL-----------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cvgD           ---------------------------------
3cvgA           ---------------------------------
3cvgC           ---------------------------------