[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL62792.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e26A.bssp"
#ERROR : Can't open dsspfile "3e25A.bssp"

## Summary of PDB Search
:394
    5e-06  38%  3e26A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-06  38%  3e25A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
3e26A           --ISVVLPALNEEATIESVIDSISVDGLVDLIVLDSGSTDDTEIRAIASGARVVSRVRPGKGEALWRSLA
3e25A           --ISVVLPALNEEATIESVIDSISVDGLVDLIVLDSGSTDDTEIRAIASGARVVSRVRPGKGEALWRSLA


                         .         .         *         .         .         .         .:140
query           YVETPYVAVLDADYTYPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           ATSGDIVVFIDSDLINP-----------------------------------------------------
3e25A           ATSGDIVVFIDSDLINP-----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e26A           --------------------------------------------
3e25A           --------------------------------------------