[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL62997.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "2yxlA.bssp"
#ERROR : Can't open dsspfile "2frxB.bssp"
#ERROR : Can't open dsspfile "2frxA.bssp"
#ERROR : Can't open dsspfile "1sqgA.bssp"
#ERROR : Can't open dsspfile "1sqfA.bssp"
#ERROR : Can't open dsspfile "2b9eA.bssp"
#ERROR : Can't open dsspfile "3gdhB.bssp"
#ERROR : Can't open dsspfile "3gdhC.bssp"
#ERROR : Can't open dsspfile "3gdhA.bssp"
#ERROR : Can't open dsspfile "2rfkA.bssp"
#ERROR : Can't open dsspfile "2hvyA.bssp"
#ERROR : Can't open dsspfile "3hjwA.bssp"
#ERROR : Can't open dsspfile "3haxA.bssp"
#ERROR : Can't open dsspfile "2ey4B.bssp"
#ERROR : Can't open dsspfile "2ey4A.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "3d79A.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "3egiD.bssp"
#ERROR : Can't open dsspfile "3egiA.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"

## Summary of PDB Search
:379
    1e-14  36%  1ixkA  [c.66.1] METHYLTRANSFERASE
    2e-13  31%  2yxlA  [x.x.x] 450AA LONG HYPOTHETICAL FMU PROTEIN
    6e-12  29%  2frxB  [x.x.x] HYPOTHETICAL PROTEIN YEBU
    6e-12  29%  2frxA  [x.x.x] HYPOTHETICAL PROTEIN YEBU
    2e-10  32%  1sqgA  [a.79.1 - c.66.1] SUN PROTEIN
    2e-10  32%  1sqfA  [a.79.1 - c.66.1] SUN PROTEIN
    2e-10  32%  2b9eA  [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    5e-06  29%  3gdhB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    9e-06  29%  3gdhC  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    9e-06  29%  3gdhA  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    1e-05  40%  2rfkA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    1e-05  40%  2hvyA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    1e-05  40%  3hjwA  [x.x.x] PSEUDOURIDINE SYNTHASE CBF5
    1e-05  40%  3haxA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    1e-05  40%  2ey4B  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    1e-05  40%  2ey4A  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    3e-05  35%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-05  35%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    6e-05  31%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    1e-04  35%  3d79A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH0734
    5e-04  33%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    6e-04  36%  3egiD  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    6e-04  36%  3egiA  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    1e-04  48%  1ixkA  [c.66.1] METHYLTRANSFERASE(query 35->84)
:379

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYI
1ixkA           ----------------------------------------------------------------------
2yxlA           -----------------------ETEDFFRSVNKRHEWISIRVNTLKANVEEVIGELEEDGVEVVRSERV
2frxB           ----------------------------------------------------------------------
2frxA           ----------------------------------------------------------------------
1sqgA           ----------------------------------------------------------------------
1sqfA           ----------------------------------------------------------------------
2b9eA           ----------------------------------------------------------------------
3gdhB           ----------------------------------------------------------------------
3gdhC           ----------------------------------------------------------------------
3gdhA           ----------------------------------------------------------------------
2rfkA           ----------------------------------------------------------------------
2hvyA           ----------------------------------------------------------------------
3hjwA           ----------------------------------------------------------------------
3haxA           ----------------------------------------------------------------------
2ey4B           ----------------------------------------------------------------------
2ey4A           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
3d79A           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
3egiD           ----------------------------------------------------------------------
3egiA           ----------------------------------------------------------------------
1ixkA           ----------------------------------PLPRCF-RVNTLKISVQDLVKRLNKKGFQFKRVPWA


                         .         .         *         .         .         .         .:140
query           DDALWVPVEGPFKIPTxxxxxxxxxxxxESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
1ixkA           -------------------------------------------------------------RVNTLKISV
2yxlA           PTIL--KIKGPYNFDT------------------------------------------------------
2frxB           ----------------------------------------------------------------------
2frxA           ----------------------------------------------------------------------
1sqgA           ----------------------------------------------------------------------
1sqfA           ----------------------------------------------------------------------
2b9eA           ----------------------------------------------------------------------
3gdhB           ----------------------------------------------------------------------
3gdhC           ----------------------------------------------------------------------
3gdhA           ----------------------------------------------------------------------
2rfkA           -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
2hvyA           -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
3hjwA           -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
3haxA           -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
2ey4B           -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
2ey4A           -----------------------------AVTHGADLAVPGIAKLHAIKRGDLVAIMTLKDELVALGKAM
2ausA           -----------------------------AVAHGANLTVPGIVKLNAIKKGDLVAIMTLKDELVALGKAM
2ausC           -----------------------------AVAHGANLTVPGIVKLNAIKKGDLVAIMTLKDELVALGKAM
2apoA           ----------------------------DAICHGADVYVRGIAKLSKIGKGETVLVETLKGEAVAVGKAL
3d79A           ------------------------------ILNGADVMAPGIVDADEIKEGDFVFVVEEKGRPLAIGIAL
3egiB           ----------------------------------------------------------------------
3egiD           ----------------------------------------------------------------------
3egiA           ----------------------------------------------------------------------
1ixkA           KEGFCLTRE-PFSI--------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
1ixkA           QDNKKGFQFKRVPWAKEGFCLTREPSITSTPEFLTGLIYIQSYPPVALDPKPGEIVADAA-----APGGK
2yxlA           ------------------------------------------------------------VDLAAAPGGK
2frxB           --------------------------LGSTAEHLSGLFYIQEASSLPVAALFADGNAPQRVDVAAAPGSK
2frxA           --------------------------LGSTAEHLSGLFYIQEASSLPVAALFADGNAPQRVDVAAAPGSK
1sqgA           ------------------------------------------------------------LDLCAAPGGK
1sqfA           ------------------------------------------------------------LDLCAAPGGK
2b9eA           LDDLRALKGKHFLLDPLMPELLVFPAQTDLPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNK
3gdhB           -------------------------------------------PEKIAEHIAGRVSQSCVVDAFCGVGGN
3gdhC           -------------------------------------------PEKIAEHIAGRVSQSFVVDAFCGVGGN
3gdhA           -------------------------------------------PEKIAEHIAGRVSQSFVVDAFCGVGGN
2rfkA           MTSQEMLEKTKGIAVDVEK---------------------------------------------------
2hvyA           MTSQEMLEKTKGIAVDVEK---------------------------------------------------
3hjwA           MTSQEMLEKTKGIAVDVEK---------------------------------------------------
3haxA           MTSQEMLEKTKGIAVDVEK---------------------------------------------------
2ey4B           MTSQEMLEKTKGIAVDVEK---------------------------------------------------
2ey4A           MTSQEMLEKTKGIAVDVEK---------------------------------------------------
2ausA           MSTQEMIERSKGIAVDVEK---------------------------------------------------
2ausC           MSTQEMIERSKGIAVDVEK---------------------------------------------------
2apoA           MNTKEILNADKGVAVDVER---------------------------------------------------
3d79A           MSGKVMKEKNRGKAVKV-----------------------------------------------------
3egiB           -------------------------------------------PEKIAEHIAGRVSQSFVVDAFCGVGGN
3egiD           -------------------------------------------PEKIAEHIAGRVSQSFVVDAFCGVGGN
3egiA           -------------------------------------------PEKIAEHIAGRVSQSFVVDAFCGVGGN
1ixkA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
1ixkA           TSYLAQLGV-IYAFDVDENRLRETRLNLSRLG--VLNVILFHSSSLLNVEFDKI-----LLDAPCTGSGT
2yxlA           TTHLAELKGKIYAFDVDKMRMKRLKDFVKRMGIKI-VKPLVKDARKAPEIIGEEVADKVLLDAPCTSIGK
2frxB           TTQISARNNEILANEFSASRVKVLHANISRCGIS-NVALTHFDGRVFGAAVPEFDA--ILLDAPCSGEGV
2frxA           TTQISARNNEILANEFSASRVKVLHANISRCGIS-NVALTHFDGRVFGAAVPEFDA--ILLDAPCSGEGV
1sqgA           TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
1sqfA           TTHILEVAAQVVAVDIDEQRLSRVYDNLKRLGMKA--TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGV
2b9eA           TSHLAALQGKIFAFDLDAKRLASMATLLARAGVEDFLAVSPSDPRYHEVHY-------ILLDPSCS--GV
3gdhB           TIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPPWGG---
3gdhC           TIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPPWGG---
3gdhA           TIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPPWGG---
2rfkA           ----------------------------------------------------------------------
2hvyA           ----------------------------------------------------------------------
3hjwA           ----------------------------------------------------------------------
3haxA           ----------------------------------------------------------------------
2ey4B           ----------------------------------------------------------------------
2ey4A           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
3d79A           ----------------------------------------------------------------------
3egiB           TIQFALTG-RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPPWADIRT
3egiD           TIQFALTG-RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPP------
3egiA           TIQFALTG-RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLL---ASFLKADVVFLSPP------
1ixkA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
1ixkA           ---IHRTDDIKFCQGLQRLLEKGLEV-LKPGGILVYSTCSLEPEENEFVIQWANFDVELLPLKYGEPALT
2yxlA           NPELRWRLREDKINEMSQLQRELLESAARLVKRLLYTTCSIFKEENEKNIRNVHPEFKLVPLKSPYDPGF
2frxB           DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
2frxA           DPDALKNWSPESNQEIAATQRELIDSALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAFLPLGDLFPG
1sqgA           HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
1sqfA           HPDIKWLRRDRDIPELAQLQSEILDAILKTGGTLVYATCSVLPEENSLQIKAFLQRTADAELETGTPE--
2b9eA           R-----------LHALAGFQQRALCHALTFPSLLVYSTCSLCQEENEDVVRDALQQNPGARLAPALPAWG
3gdhB           -PDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVY----------------------------------
3gdhC           -PDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVY----------------------------------
3gdhA           -PDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVY----------------------------------
2rfkA           ----------------------------------------------------------------------
2hvyA           ----------------------------------------------------------------------
3hjwA           ----------------------------------------------------------------------
3haxA           ----------------------------------------------------------------------
2ey4B           ----------------------------------------------------------------------
2ey4A           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
3d79A           ----------------------------------------------------------------------
3egiB           SPDGFE--IFRLSKKITNNIVYFL----------------------------------------------
3egiD           ----------------------------------------------------------------------
3egiA           ----------------------------------------------------------------------
1ixkA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CRECRRFLPHVHNTPGFFIAVLRGARKEP
1ixkA           IKNARRLYPDVHETSGFFIAKIR------
2yxlA           LEGTMRAWPHRHSTIGFFYALL-------
2frxB           ANKALHVFPQIYDCEGFFVARLRKTQAIP
2frxA           ANKALHVFPQIYDCEGFFVARLRKTQAIP
1sqgA           -QPGKQNLPGAEEGDGFFYAKL-------
1sqfA           -QPGKQNLPGAEEGDGFFYAKL-------
2b9eA           AEHCLRASPETTLSSGFFVAVI-------
3gdhB           -----------------------------
3gdhC           -----------------------------
3gdhA           -----------------------------
2rfkA           -----------------------------
2hvyA           -----------------------------
3hjwA           -----------------------------
3haxA           -----------------------------
2ey4B           -----------------------------
2ey4A           -----------------------------
2ausA           -----------------------------
2ausC           -----------------------------
2apoA           -----------------------------
3d79A           -----------------------------
3egiB           -----------------------------
3egiD           -----------------------------
3egiA           -----------------------------
1ixkA           -----------------------------