[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL63787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2rc3C.bssp"
#ERROR : Can't open dsspfile "2rc3B.bssp"
#ERROR : Can't open dsspfile "2rc3A.bssp"
#ERROR : Can't open dsspfile "2ef7B.bssp"
#ERROR : Can't open dsspfile "2ef7A.bssp"
#ERROR : Can't open dsspfile "2yziB.bssp"
#ERROR : Can't open dsspfile "2yziA.bssp"
#ERROR : Can't open dsspfile "2rifD.bssp"
#ERROR : Can't open dsspfile "2rifC.bssp"
#ERROR : Can't open dsspfile "2rifB.bssp"
#ERROR : Can't open dsspfile "2rifA.bssp"
#ERROR : Can't open dsspfile "2yvxA.bssp"
#ERROR : Can't open dsspfile "2yvyA.bssp"
#ERROR : Can't open dsspfile "1xkfB.bssp"
#ERROR : Can't open dsspfile "2yzqA.bssp"
#ERROR : Can't open dsspfile "1xkfA.bssp"
#ERROR : Can't open dsspfile "2qh1B.bssp"
#ERROR : Can't open dsspfile "2qh1A.bssp"
#ERROR : Can't open dsspfile "1pvmB.bssp"
#ERROR : Can't open dsspfile "1pvmA.bssp"
#ERROR : Can't open dsspfile "3fhmC.bssp"
#ERROR : Can't open dsspfile "3fhmB.bssp"
#ERROR : Can't open dsspfile "3fhmA.bssp"
#ERROR : Can't open dsspfile "3fhmD.bssp"
#ERROR : Can't open dsspfile "2o16A.bssp"
#ERROR : Can't open dsspfile "1zfjA.bssp"
#ERROR : Can't open dsspfile "2yvzA.bssp"
#ERROR : Can't open dsspfile "2j9lA.bssp"
#ERROR : Can't open dsspfile "1uipA.bssp"
#ERROR : Can't open dsspfile "1uioA.bssp"
#ERROR : Can't open dsspfile "1fkxA.bssp"
#ERROR : Can't open dsspfile "1fkwA.bssp"
#ERROR : Can't open dsspfile "1a4mA.bssp"
#ERROR : Can't open dsspfile "2j9lD.bssp"
#ERROR : Can't open dsspfile "2j9lC.bssp"
#ERROR : Can't open dsspfile "2j9lB.bssp"
#ERROR : Can't open dsspfile "2j9lF.bssp"
#ERROR : Can't open dsspfile "2o16B.bssp"
#ERROR : Can't open dsspfile "3ddjA.bssp"
#ERROR : Can't open dsspfile "2bj9A.bssp"
#ERROR : Can't open dsspfile "2bj7A.bssp"
#ERROR : Can't open dsspfile "2bj3C.bssp"
#ERROR : Can't open dsspfile "2bj3B.bssp"
#ERROR : Can't open dsspfile "2bj3A.bssp"
#ERROR : Can't open dsspfile "2bj1A.bssp"

## Summary of PDB Search
:142
    3e-14  38%  2rc3C  [x.x.x] CBS DOMAIN
    3e-14  37%  2rc3B  [x.x.x] CBS DOMAIN
    3e-14  38%  2rc3A  [x.x.x] CBS DOMAIN
    2e-12  38%  2ef7B  [x.x.x] HYPOTHETICAL PROTEIN ST2348
    2e-12  38%  2ef7A  [x.x.x] HYPOTHETICAL PROTEIN ST2348
    4e-12  33%  2yziB  [x.x.x] HYPOTHETICAL PROTEIN PH0107
    4e-12  33%  2yziA  [x.x.x] HYPOTHETICAL PROTEIN PH0107
    9e-12  37%  2rifD  [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
    9e-12  37%  2rifC  [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
    9e-12  37%  2rifB  [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
    9e-12  37%  2rifA  [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
    1e-10  35%  2yvxA  [x.x.x] MG2+ TRANSPORTER MGTE
    5e-10  33%  2yvyA  [x.x.x] MG2+ TRANSPORTER MGTE
    1e-09  29%  1xkfB  [x.x.x] HYPOTHETICAL PROTEIN RV2626C
    5e-09  35%  2yzqA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH1780
    5e-09  28%  1xkfA  [x.x.x] HYPOTHETICAL PROTEIN RV2626C
    7e-09  28%  2qh1B  [x.x.x] HYPOTHETICAL PROTEIN TA0289
    7e-09  28%  2qh1A  [x.x.x] HYPOTHETICAL PROTEIN TA0289
    7e-09  28%  1pvmB  [d.37.1 - d.37.1 - g.41.13] CONSERVED HYPOTHETICAL PROTEIN
    7e-09  28%  1pvmA  [d.37.1 - d.37.1 - g.41.13] CONSERVED HYPOTHETICAL PROTEIN
    7e-09  29%  3fhmC  [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
    7e-09  29%  3fhmB  [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
    7e-09  29%  3fhmA  [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
    1e-06  28%  3fhmD  [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
    4e-06  29%  2o16A  [x.x.x] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE
    5e-06  29%  1zfjA  [c.1.5 - d.37.1 - d.37.1] INOSINE MONOPHOSPHATE DEHYDROGENASE
    3e-05  41%  2yvzA  [x.x.x] MG2+ TRANSPORTER MGTE
    6e-05  30%  2j9lA  [x.x.x] CHLORIDE CHANNEL PROTEIN 5
    1e-04  28%  1uipA  [x.x.x] ADENOSINE DEAMINASE
    1e-04  28%  1uioA  [x.x.x] ADENOSINE DEAMINASE
    1e-04  28%  1fkxA  [x.x.x] ADENOSINE DEAMINASE
    1e-04  28%  1fkwA  [x.x.x] ADENOSINE DEAMINASE
    1e-04  28%  1a4mA  [c.1.9] ADENOSINE DEAMINASE
    1e-04  32%  2j9lD  [x.x.x] CHLORIDE CHANNEL PROTEIN 5
    1e-04  32%  2j9lC  [x.x.x] CHLORIDE CHANNEL PROTEIN 5
    1e-04  32%  2j9lB  [x.x.x] CHLORIDE CHANNEL PROTEIN 5
    2e-04  32%  2j9lF  [x.x.x] CHLORIDE CHANNEL PROTEIN 5
    3e-04  29%  2o16B  [x.x.x] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE
    9e-04  24%  3ddjA  [x.x.x] CBS DOMAIN-CONTAINING PROTEIN
    9e-04  35%  2bj9A  [x.x.x] NICKEL RESPONSIVE REGULATOR
    9e-04  35%  2bj7A  [x.x.x] NICKEL RESPONSIVE REGULATOR
    9e-04  35%  2bj3C  [x.x.x] NICKEL RESPONSIVE REGULATOR
    9e-04  35%  2bj3B  [x.x.x] NICKEL RESPONSIVE REGULATOR
    9e-04  35%  2bj3A  [x.x.x] NICKEL RESPONSIVE REGULATOR
    9e-04  35%  2bj1A  [x.x.x] NICKEL RESPONSIVE REGULATOR
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
2rc3C           ----------VVAIGPDDSVFNAMQKMAADNIGALLVMKDEK--LVGILTERDFSRKSYLLDKPVKDVKE
2rc3B           ----------VVAIGPDDSVFNAMQKMAADNIGALLVMKDEK--LVGILTERDFSRKLLKPVKDTQ-VKE
2rc3A           ----------VVAIGPDDSVFNAMQKMAADNIGALLVMKDEK--LVGILTERDFSRKSYLLDKPVKDVKE
2ef7B           ----------VISVTKDAKLNDIAKV-TEKNIGSVIVVDGNKP--VGIITERDIVKAIGKG-KSLETKAE
2ef7A           ----------VISVTKDAKLNDIAKV-TEKNIGSVIVVDGNKP--VGIITERDIVKAIGKG-KSLETKAE
2yziB           -----VYTKKLLGVKPSTSVQEASRL--EFDVGSLVVIND-DGNVVGFFTKSDIIRVIVPGLPYDIPVER
2yziA           -----VYTKKLLGVKPSTSVQEASRL--EFDVGSLVVIND-DGNVVGFFTKSDIIRVIVPGLPYDIPVER
2rifD           -----------------ATIREVATELAKNRVGLAVLTANPKRPVA-VVSERDILRAVAQRLDLDGPAMP
2rifC           -----------------ATIREVATELAKNRVGLAVLTANPKRPVA-VVSERDILRAVAQRLDLDGPAMP
2rifB           -----------------ATIREVATELAKNRVGLAVLTANPKRPVA-VVSERDILRAVAQRLDLDGPAMP
2rifA           -----------------ATIREVATELAKNRVGLAVLTANPKRPVA-VVSERDILRAVAQRLDLDGPAMP
2yvxA           --AGGLMTPEYVAVREGMTVEEVLRFLRRAETIYYIYVVDEKGRLKGVLSLRDLIVA-----DPRTRVAE
2yvyA           --AGGLMTPEYVAVREGMTVEEVLRFLRRAETIYYIYVVDEKGRLKGVLSLRDLIVA-----DPRTRVAE
1xkfB           MNAG------VTCVGEHETLTAAAQYMREHDIGALPICGDDDR-LHGMLTDRDIIKGLAAGLDPNTATAG
2yzqA           ---------------------------------------DSEGNLVGIVDETDLLRD-SEIVRPNKPVAE
1xkfA           MNAG------VTCVGEHETLTAAAQYMREHDIGALPICGDDDR-LHGMLTDRDIIKGLAAGLDPNTATAG
2qh1B           MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIRFIPRNKKPDEPIRL
2qh1A           MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIRFIPRNKKPDEPIRL
1pvmB           MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIRFIPRNKKPDEPIRL
1pvmA           MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIRFIPRNKKPDEPIRL
3fhmC           --------RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASQSVSV
3fhmB           --------RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASQSVSV
3fhmA           --------RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASQSVSV
3fhmD           --------RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGAASLQQSVSV
2o16A           ---------------------DAKHLMEALDIRHVPIV-DANKKLLGIVSQRDLLAAQESSLQFETPLFE
1zfjA           -------------LTPEHKVSEAEELQRYRISGVPIVETLANRKLVGIITNRD--RFIS---DYNAPISE
2yvzA           ---------------------------------YYIYVVDEKGRLKGVLSLRDLIVA-----DPRTRVAE
2j9lA           --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
1uipA           ----------------------------------------------GDVTPDDVVDLVNQGLQEGEQAFG
1uioA           ----------------------------------------------GDVTPDDVVDLVNQGLQEGEQAFG
1fkxA           ----------------------------------------------GDVTPDDVVDLVNQGLQEGEQAFG
1fkwA           ----------------------------------------------GDVTPDDVVDLVNQGLQEGEQAFG
1a4mA           ----------------------------------------------GDVTPDDVVDLVNQGLQEGEQAFG
2j9lD           --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
2j9lC           --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
2j9lB           --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVRN
2j9lF           --------------------------------GFPVVVSRESQRLVGFVLRRDLIISIENGVVSTSIIRN
2o16B           ---------------------DAKHLMEALDIRHVPIV-DANKKLLGIVSQRDLLAAQESSSLAFEPLFE
3ddjA           -----------------------------RNFGSLPVV-DINDKPVGIVTEREFL-LLYKDLDEIFPV-K
2bj9A           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2bj3A           ----------------------------------------------------------------------
2bj1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEISA
2rc3C           IMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKDA-------------------
2rc3B           IMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKDA-------------------
2rc3A           IMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKDA-------------------
2ef7B           EFTASLITIREDSPITG-ALALRQFNIRHLPVVDDGNLKGIISIRDITRAID------------------
2ef7A           EFTASLITIREDSPITG-ALALRQFNIRHLPVVDDGNLKGIISIRDITRAID------------------
2yziB           I-TRNLITANVNTPLGEVLR-KAEHRIKHILIEEEGKIVGIFTLSDLLEAS-------------------
2yziA           I-TRNLITANVNTPLGEVLR-KAEHRIKHILIEEEGKIVGIFTLSDLLEAS-------------------
2rifD           IANSPITVLDTD-PVHVAAEKMRRHNIRHXXXXNNGELVGVLSIRDLCFERAILLEL-------------
2rifC           IANSPITVLDTD-PVHVAAEKMRRHNIRHXXXXNNGELVGVLSIRDLCFERAILLEL-------------
2rifB           IANSPITVLDTD-PVHVAAEKMRRHNIRHXXXXNNGELVGVLSIRDLCFERAILLEL-------------
2rifA           IANSPITVLDTD-PVHVAAEKMRRHNIRHXXXXNNGELVGVLSIRDLCFERAILLEL-------------
2yvxA           IMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEGRLVGIVTVDDVL---DVLE---AEATEDIHKLGA
2yvyA           IMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEGRLVGIVTVDDVL----------------------
1xkfB           ELARSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIAR---------------------
2yzqA           IMTRDVIVATPHMTVHEVALKMAKYSIEQLVIRGEGDLIGLIRDFDLLK---------------------
1xkfA           ELA--IYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIAR---------------------
2qh1B           VMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDGRVVGIVTLTDL-----------------------
2qh1A           VMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDGRVVGIVTLTDL-----------------------
1pvmB           VMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDGRVVGIVTLTDL-----------------------
1pvmA           VMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDGRVVGIVTLTDL-----------------------
3fhmC           AMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK---------------------
3fhmB           AMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK---------------------
3fhmA           AMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK---------------------
3fhmD           AMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPV--EGRLAGIISIGDVVK---------------------
2o16A           VMHTDVTSVAPQAGLKESAIYMQKHKIGCLPVVAKDVLVGIITDSDFV---TIAINLLELQEE-------
1zfjA           HTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNGRLSGLITIKD-------IEKVIEFPHAAKDE---
2yvzA           I-NPKVVYVRTDTDQEEVARL-ADYDFTVLPVVDEGRLVGIVTVDDVL----------------------
2j9lA           ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANFNEFLE--------
1uipA           IKVRSILCCMRHQPSWEVLELCKKYNQKTVVAMD------------------------------------
1uioA           IKVRSILCCMRHQPSWEVLELCKKYNQKTVVAMD------------------------------------
1fkxA           IKVRSILCCMRHQPSWEVLELCKKYNQKTVVAMD------------------------------------
1fkwA           IKVRSILCCMRHQPSWEVLELCKKYNQKTVVAMD------------------------------------
1a4mA           IKVRSILCCMRHQPSWEVLELCKKYNQKTVVAMD------------------------------------
2j9lD           ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
2j9lC           ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
2j9lB           ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
2j9lF           ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK---------------------
2o16B           VMHTDVTSVAPQAGLKESAIYMQKHKIGCLPVVAKDVLVGIITDSDFV---TIAINLLELQEE-------
3ddjA           VFSTKVQTIYKEVRLDQAVKLLRRGFRRLPVIDDDNKVVGIVTVVNAIKQ--------------------
2bj9A           -----------------IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI--
2bj7A           -----------------IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI--
2bj3C           -----------------IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI--
2bj3B           -----------------IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI--
2bj3A           -----------------IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI--
2bj1A           -----------------IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI--


                         +         .         .         .         .         *         .:210
query           HD
2rc3C           --
2rc3B           --
2rc3A           --
2ef7B           --
2ef7A           --
2yziB           --
2yziA           --
2rifD           --
2rifC           --
2rifB           --
2rifA           --
2yvxA           VD
2yvyA           --
1xkfB           --
2yzqA           --
1xkfA           --
2qh1B           --
2qh1A           --
1pvmB           --
1pvmA           --
3fhmC           --
3fhmB           --
3fhmA           --
3fhmD           --
2o16A           --
1zfjA           --
2yvzA           --
2j9lA           --
1uipA           --
1uioA           --
1fkxA           --
1fkwA           --
1a4mA           --
2j9lD           --
2j9lC           --
2j9lB           --
2j9lF           --
2o16B           --
3ddjA           --
2bj9A           --
2bj7A           --
2bj3C           --
2bj3B           --
2bj3A           --
2bj1A           --