[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for paer1:AAL63906.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uf2B.bssp"
#ERROR : Can't open dsspfile "1uf2A.bssp"

## Summary of PDB Search
:97
    8e-04  27%  1uf2B  [e.28.1] CORE PROTEIN P3
    8e-04  27%  1uf2A  [e.28.1] CORE PROTEIN P3
:97

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxLRALIEFKARRAGRNPGEVFQKPWLFLRYVEEALGRHNAELISTLFVEFVRRR
1uf2B           -----------------IRAVYDTLSNKLGRNPADIFHLEEVF-KVIE--------EIVSVLVQQKIDVR
1uf2A           -----------------IRAVYDTLSNKLGRNPADIFHLEEVF-KVIE--------EIVSVLVQQKIDVR


                         .         .         *         .         .         .         .:140
query           RIYAQSAAEALWSEEGWRRFLQxxxxx
1uf2B           KYFTESMRSGSFSKPRWDNFLR-----
1uf2A           KYFTESMRSGSFSKPRWDNFLR-----